Tag: "addressed" at biology news

'Lessons learned' highlighted as global politics of HIV/AIDS examined in new research

...lure to act for broader society. These themes are addressed across national and social contexts and analytical approaches by the four symposium articles: In "Written in Blood: AIDS Prevention and the Politics of Failure in France" Michael Bosia (St. Michaels College) examines the French governments slow res...

Nanotech safety needs specific government risk research strategy and funding

...alth and safety questions that are important to be addressed for nanotechnology are reasonably straightforward," according to Maynard. "And a lot already has been published about what we know and do not know about the potential risks and about how to fill existing research gaps." "Far harder is getting the f...

Public shares views on environmental, health and safety research needs for nanoscale materials

...ons, and risk assessment consulting organizations, addressed representatives of government agencies with responsibilities in the area of nanotechnology. The agencies of the NNI had requested input on the research needs, identified in a document published in September 2006, and on the prioritization criteria f...

Maxine Singer awarded 2007 NAS Public Welfare Medal

...on Science, Engineering, and Public Policy, Singer addressed graduate education, postdoctoral scholarship, the plight of women in science, and scientific conduct. Under her leadership, the committee has had a major effect on science policy, producing influential reports including "Scientific and Medical Aspect...

Maxine F. Singer to receive Public Welfare Medal

...on Science, Engineering, and Public Policy, Singer addressed significant issues involving graduate education, postdoctoral scholars, women in science, and scientific conduct. Under her leadership, the committee's findings have had a major effect on science policy, producing influential reports such as SCIENTI...

Best practices for parenterals: From formulation to manufacturing

...logics. The broad range of topics featured will be addressed with presentations from field experts followed by group discussion and specific case studies. A keynote address by Dr. Michael Akers of Baxter BioPharma Solutions kicks off the meeting with an overview of parenteral research in his speech "Top Ten Sc...

The hitchhiker's guide to altruism -- Study explains how costly traits evolve

...stly traits evolve? In the past, two theories have addressed this problem. The theory of hitchhiking suggests that genes that confer a cost to their bearer can become common in natural populations when they "hitch a ride" with fitter genes that are being favored by natural selection. Conversely, the theory of ...

News tips from the Journal of Neuroscience

... to synaptic membranes. This week, Gorczyca et al. addressed the complex process of targeted membrane addition at the larval Drosophila neuromuscular junction, particularly the specialized, multilayered postsynaptic membrane called the subsynaptic reticulum (SSR). The authors used the guanylate kinaselike do...

Nectar is not a simple soft drink

...te for Chemical Ecology in Jena, Germany, recently addressed the question, why would plants risk poisoning the insects and birds that provide pollination services? Their findings have been published in The Plant Journal. Kessler and Baldwin examined the nectar of a wild tobacco species, Nicotiana attenuata, ...

Music genes and musical geniuses

...urpose of music? These and other questions will be addressed by geneticists, psychologists, biologists, but also anthropologists and musicologists during the open conferences hosted in the Palazzo del Podest. All this is not just caused by curiosity: studying the way music is read, interpreted and appreciated ...

International Conference on Modern Bamboo Structures Oct. 11-17

...analysis, modern examples and more. Topics to be addressed include: Properties of bamboo materials, components Experimental testing, analysis of bamboo structures and components Design concepts for modern bamboo structures Modern bamboo buildings and bridges Composites of bamboo, timber and...

Super-fermenting fungus genome sequenced

...sic ethanol production, one major detour has being addressed with the characterization of the genetic blueprint of the fungus Pichia stipitis, by the U.S. Department of Energy Joint Genome Institute (DOE JGI) and collaborators at the U.S. Forest Service, Forest Products Laboratory (FPL). The research, entaili...

Solar energy conversion offers a solution to help mitigate global warming

...y conversion as an alternative to fossil fuels are addressed in the Physics Today article, co-authored by George Crabtree, senior scientist and director of Argonne's Materials Science Division, and Nathan Lewis, professor of Chemistry at Caltech and director of its Molecular Materials Research Center. Curren...

Carbon dioxide and the ocean

...s. The paper aims to consolidate research that has addressed how carbon dioxide emissions since the industrial revolution have dramatically changed natural patterns in atmospheric and oceanic ecosystems. "This paper is really a broad look at where scientific research is going in the future and where we need ...

Plant size morphs dramatically as scientists tinker with outer layer

...d Function, conducted a series of experiments that addressed an old debated question: what tissues of the leaf drive or restrict growth? The answer was simple: the epidermis is in control. They found that when they drive the expression of the BRI1 receptor in the epidermis of a dwarf Arabidopsis, while leav...

Social tolerance allows bonobos to outperform chimpanzees on a cooperative task

...s to cooperate in retrieving food, the researchers addressed two hypotheses. The first, the so-called "emotional reactivity hypothesis," predicts that bonobos will cooperate more successfully, because past observations have indicated that they are more tolerant of other individuals than are chimpanzees. In con...

Nanotechnology oversight requires thinking outside the box

...received the attention they deserve but need to be addressed as soon as possible." Greenwood also emphasizes the importance of openness in the risk-management decision-making process. "While recognizing the need to protect intellectual property and to be sensitive to other business concerns, efforts to devis...

International risk research strategy and funding needed for nanotech safety

...alth and safety questions that are important to be addressed for nanotechnology are reasonably straightforward, noted Maynard. And a lot already has been published about what we know and do not know about the potential risks and about how to fill existing research gaps. Far harder is getting governments to set...

Building green made easier with new roadmap

...y sizing, as well as a summary of key issues to be addressed and references to additional resources. The Green Studio Handbook was written to serve as a reference guide and source of inspiration for students in design studios and architects in professional practice, the co-authors wrote. It is founded upon t...

Atlas of Science Literacy completes mapping of science-learning pathways

...notations about how and when related topics can be addressed with students were popular features among the teachers." The release of Atlas 2 coincides with new challenges for teachers and a renewed interest in U.S. science education, said NSTA President Linda Froschauer, an eighth-grade teacher in Weston, ...

1 2 3 4 5 6 7 8 9

(Date:10/31/2014)... good for attracting species, but it may not be enough ... study has found. , The researchers surveyed two types of ... abundance of two insects that interact with them. They found ... and black walnut, they didn,t find a corresponding abundance of ... the walnuts and black cherries and a type of wasp ...
(Date:10/31/2014)... 30, 2014  HITLAB SM , a healthcare ... its inaugural HITLAB Innovators Summit SM on ... HITLAB will partner with the Clinton Foundation,s Health ... ProtoHack, Columbia Business School Alumni Club of ... Engineering and Operations Research, bringing together leaders in ...
(Date:10/30/2014)... 2014—Oligonucleotide-based therapeutics present unique challenges when it comes ... developmental harm. New consensus guidelines for toxicity testing ... biological characteristics of these novel biopharmaceuticals are presented ... journal from Mary Ann Liebert, Inc. publishers ... Nucleic Acid Therapeutics website until November ...
Breaking Biology News(10 mins):Green spaces don't ensure biodiversity in urban areas 2HITLAB Announces Inaugural HITLAB Innovators Summit 2HITLAB Announces Inaugural HITLAB Innovators Summit 3New guidelines for reproductive & developmental toxicity testing of oligonucleotide drugs 2
Other Tags
despiteeasyfrogsdeformedarrivestartpartyamokcorporateresponsibilitywalkspercentageaffectingfundsaimssporting