Tag: "analyses" at biology news

Head lice reveal contact between modern and ancient humans

...and is restricted to the New World. However, their analyses also provide evidence that P. humanus must have originated long before its H. sapiens host and that the New World lineage remained isolated from the worldwide one for most of the past 1.18 million years. It is unlikely, the authors argue, that tw...

Bovine genome assembled

...that have already been sequenced. Results of these analyses will begin to be published in the public databases in the next several months. The bovine genome is similar in size to the genomes of humans and other mammals, containing approximately 3 billion DNA base pairs. In addition to helping medical researc...

Bovine genome sequence available

...have already been sequenced. The results of these analyses will be published on public databases in the next several months. Sequencing and assembly of the bovine genome began in December 2003, led by Richard Gibbs and George Weinstock at the Baylor College of Medicine's Human Genome Sequencing Center in...

Society for Psychophysiology Research

...vents, however, linger for much longer. Linguistic analyses of emotional upheavals such as 9/11 find that naturally-occurring emotional responses can last for weeks or even months. What, if any, emotion regulation strategies can work for extended periods of time? A series of studies will be presented that sug...

Laboratory test of evolutionary theory confirms importance of links between populations

...n actually translating that theory into predictive analyses of natural populations." The experiments used a simplified system in the laboratory to test the predictions of the theory. The basic coevolutionary dynamics of E. coli bacteria and bacteriophage T7 are well known. When T7 is introduced to a populatio...

Scientists fear threat of second wave of 'mad cow' prion infection

...asymptomatic donors who later died of vCJD and new analyses of the disease's probable amplification around the world. New data on technology to prevent transfusion-transmitted prions will be presented at the annual AABB blood conference in Baltimore. Experts convening for symposium at AABB on TSE and the bl...

International human genome sequencing consortium describes finished human genome sequence

...d in Feb. 2001. Even more detailed annotations and analyses have already been published for chromosomes 5, 6, 7, 9, 10, 13, 14, 19, 20, 21, 22 and Y. Publications describing the remaining 12 chromosomes are forthcoming....

New DNA repair enzyme makes mistakes to save lives of cells

...s, we will be performing more detailed biochemical analyses and structural studies to determine if our impressions are correct," said Mineaki Seki, Ph.D., research associate in the basic research division at UPCI and the paper's first author. Additional studies also will provide researchers with more insight...

New genomic method can identify disease-causing genes

... the "mouse to man" approach is widely used. Since analyses of mouse genetic models by traditional methods are very time-consuming and costly, this novel computational approach represents a major advance for this entire field of research. Study participants from Roche included Guochun Liao, Jianmei Wa...

New method studies living bacterial cells

...fluorescence measurements for mapping and chemical analyses of single free-floating, or planktonic, and surface-adhered, or biofilm, cells of Pseudomonas fluorescens. The results showed differences between the planktonic and adhered cells in morphology, elemental composition and sensitivity to hexavalent chro...

Gene for common form of Parkinson's pinpointed

...ed evidence of having PARK8 PD. Their systematic analyses of the PARK8 locus led them to track down mutations that all had in the gene encoding dardarin. Evidence implicating dardarin includes the fact that it is expressed throughout the brain and that the characteristic mutations in dardarin are not pres...

Munching microbes could cleanse arsenic-contaminated groundwater

...system," said graduate student Matthew Kirk. "Our analyses suggest the aquifer is divided into zones of mixed microbial activity, some dominated by sulfate-reducing bacteria, others by methanogens."Sulfate-reducing bacteria will consume sulfate and reduce it into sulfide. The sulfide then reacts to precipit...

Researchers uncover how infections combat plant immune responses

...known to interfere with plant development, further analyses of the CTV suppressors will explain why CTV is capable of such destructive effects. One approach for the control of CTV in a number of labs is to genetically engineer virus-resistant citrus trees. "Our findings will help improving the efficacy of th...

High-predator environment has unexpected impact on aging in fish

...acceleration and maximum swimming speed, which are analyses of neuromuscular performance. In youth, guppies from high-predation environments are faster than those from low predation environments. All guppies slowed down with age, but the rate of decline for fish in high-predation environments was faster so th...

Global warming's impact on US plants, animals determined from review of dozens of studies

... with the University of Colorado at Boulder. Their analyses revealed that more than half the studies provided strong evidence of a direct link between global warming and changes in the behavior of species in the continental United States and Alaska. "Other recent syntheses of biological impacts, including my ...

New Royal Society journal studies

...cline prior to human settlement. Using new genetic analyses on an extinct species for the first time we have been able to shed light on this mystery. We estimate that, as little as 1,000 years ago, the standing population of moa was c. 312 million. This estimate is much larger than the accepted population est...

Scientists advocate genomic sequencing of 'living fossil'

...genome a better reference for comparative sequence analyses involving land vertebrates than teleost genomes, which are commonly used for such studies but are highly derived due to a whole-genome duplication event. For these reasons, Myers and colleagues argue that the complete genomic sequence of the coelaca...

Other highlights in the November 17 JNCI

...ncluding colorectal cancer. In addition, secondary analyses of data from a large randomized clinical trial suggested that selenium intake reduces the risk of colorectal cancer, but epidemiologic data has not found a consistent association. Elizabeth T. Jacobs, Ph.D., of the Arizona Cancer Center in Tucson, an...

Studies suggest promising new directions for gallstone treatment

...sease that is observed in humans. The researchers' analyses of bile components in the knockout mice revealed cholesterol saturation and lower levels of biliary lipids, resulting in cholesterol crystals -- conditions that closely matched those seen in humans with CGD. They also found that the bile acids create...

Visualizing the end of the human genome

...milar design, but the results of their biochemical analyses of the protein did not fit easily with this model. For example, when the scientists added the protein to short pieces of DNA containing the six nucleotides that make up a human telomeric repeat, the human POT1 protein bound poorly. To their sur...

1 2 3 4 5 6 7 8 9 10

(Date:5/16/2013)... -- Injectable nanoparticles developed at MIT may someday ... diabetes to constantly monitor their blood-sugar levels and ... designed to sense glucose levels in the body ... insulin, thereby replacing the function of pancreatic islet ... 1 diabetes. Ultimately, this type of system could ...
(Date:5/16/2013)... relationship between the heritable risk for schizophrenia and ... is commonly associated with cognitive impairments that may ... IQ may be linked to the risk for ... precede the onset of schizophrenia symptoms. Also, these ... people diagnosed with schizophrenia. , In a remarkable ...
(Date:5/16/2013)... May 16, 2013 Integrated Biometrics patented ... a custom thin film transistor camera introduces Sherlock, ... roll image in the smallest and lightest form ... Appendix F Mobile ID FAP 45, Certified scanner ... in size and weight when compared to optical ...
Breaking Biology News(10 mins):Nanotechnology could help fight diabetes 2Nanotechnology could help fight diabetes 3Genetic risk for schizophrenia is connected to reduced IQ 2
Other Tags
sarawakmalaysianweevilnicetrendupwardpredisposingemphasiscouricmovieadvisestraymitigatesolicitousnessgastroenteritisgatorade