The Latest Biology News And Medical NewsBiology News 2Health News 2Biology News 3Health News 3


Tag: "autism" at biology news

Deciphering an autism mystery

...sts have found that a specific gene contributes to autism and that autistic people have fewer receptors for ...ually encompasses a wide array of symptoms--called autism spectrum disorder (ASD)--including various degrees of behavioral, developmental, and sensory deficit...

Support for fragile X syndrome needed

...most children with fragile X are 'coded' under the autism category." Indeed, many parents and educators of FXS children lack relevant information or the appropriate resources. "We hope this FXS conference will serve as a building block to establish a future network parent-teacher network," says Cornish. "Ou...

Children's Hospital Boston launches major genetic study of autism

...art of an ambitious new multidisciplinary study of autism that will attempt to pin down its genetic and bioc...ential medical treatments. More than 90 percent of autism cases are believed to have a genetic component, and multiple genes are believed to be involved. But ...

Genetic defect confers risk of major depression, resistance to SSRI drug therapy

... generalized anxiety disorders, suicidal behavior, autism and drug abuse -- and in those with adverse reactions to treatment with SSRIs. Collaborators on the study include Raul Gainetdinov, Jean-Martin Beaulieu, Tatyana Sotnikova, Lauranell Burch, Redford Williams and David Schwartz, all of Duke....

Clam embryo study shows pollutant mixture adversely affects nerve cell development

...provide clues about such neurological mysteries as autism spectrum disorder or attention deficit hyperactivi...r 2000 that documented a higher than usual rate of autism spectrum disorder and explored its link to bromoform, chloroform, and tetrachloroethylene in Brick's...

Media fellowship on autism available at Vanderbilt University

...tic testing and debate regarding how best to treat autism are all changing the landscape of diagnosing, educ...n experts, advocates, parents and individuals with autism to discuss with journalists the latest research, the rising incidence of autism, the debate over its...

Columbia researcher identifies cellular defect that may contribute to autism

NEW YORK, NY, January 27 The causes of autism have long remained a mystery, but new research from Columbia University Medical Center has identified, for the first time, how a cellular defect may be involved in the often crippling neurological disorder. The research, which is published in today...

Rats infected as newborns grew up vulnerable to memory problems during an immune challenge

...al infection has been implicated in schizophrenia, autism and cerebral palsy; bacterial infection is a risk factor for Parkinson's disease. Up to 20 percent of pregnancies have complications involving infections of the uterus and its contents, a number that will rise as more children are born premature. In...

A startling diary reveals the onset of autism

...three years of age. "It appears that children with autism develop normally for six months, and then begin de...o accelerate in social development, the child with autism makes only minor gains." During the first six months, both twins smiled, engaged in socially respon...

Autism media fellowship available at Vanderbilt University

...ists will have an opportunity to meet with leading autism researchers and affected families to learn about t...ents identify the potential early warning signs of autism are sure to keep this story in the forefront of public attention. The fellowship application dead...

Autism linked to mirror neuron dysfunction

...phalograph (EEG) recordings of 10 individuals with autism show a dysfunctional mirror neuron system: Their m...intentions and empathize with their pain. Because autism is characterized, in part, by deficits in exactly these sorts of social interaction and communicatio...

NNii media advisory about David Kirby's book questioning vaccine safety

...orting that there is a link between thimerosal and autism and other developmental disorders. This book (for ...studies. Continued attempts to link vaccines and autism run the risk of diverting attention away from efforts to understand the cause or causes of autism. ...

Gene mutated in cancer found in some with autism

...ree of 18 people with larger than normal heads and autism spectrum disorder. Autism spectrum disorder includ...etics, raise the possibility that some people with autism and large heads may have an increased risk of cancer. "If our findings are verified, I think that pa...

UCLA scientists pinpoint region of autism gene on chromosome 17

... geneticists have isolated the likely region of an autism gene on chromosome 17 and then successfully duplic...ere surprised to find that the gene contributes to autism only in boys, perhaps explaining why girls have a dramatically lower risk of developing the disease....

Birth factors associated with risk for autism

...to be associated with an increased risk to develop autism later in childhood. The study is published in the ...spitals after a diagnosis of infantile or atypical autism through November 1999. Information on the children's parents was also obtained. The initial data was...

Love's all in the brain: fMRI study shows strong, lateralized reward, not sex, drive

...jor predictions, yields "remarkable implications"; autism link Aron reported that, using functional magne... forms of autism," Brown added. "Some people with autism don't understand or experience any sort of emotional attachment or romantic love. I would speculate...

Rodent social behavior encoded in junk DNA

...xplain human social behavior and disorders such as autism has been made in a species of pudgy rodents by res...nd perhaps influence disorders of sociability like autism and social anxiety disorders, suggest the researchers. The Emory researchers have found that the bon...

Study strengthens link between Foxp2 gene and language development

...d to other disorders that affect speech, including autism and specific language impairment (a broad diagnosis used to describe communication difficulties in the absence of mental retardation, hearing loss, or emotional disorders). In the study, the team engineered mice with either one or both disrupted copi...

APS oxytocin/vasopressin conference: 13 highlighted presentations

.../conference/index.htm Larry Young on animals and autism clues, environmental impact on hormone brain function Young began studying voles for their monogamous behavior, then investigated molecular mechanisms in species behavior differences. Now researchers are gaining insights into human disorders with so...

Larry Young on animals and autism clues, environmental impact on hormone brain function

... of autism. Animals just don't get autism. Second, autism is itself a disrupted social phenotype with a broa...al viewpoints," Young added. Opening the door on autism Based on earlier work by Thomas Insel and Sue Carter on voles, Young's laboratory has focused on OT...

1 2 3 4 5

(Date:12/1/2008)...ineered crops, sequencing the genome could be cons...e sequence is complete, the baton is passed forwar...raft sequence of the soybean genome is now availab.... Taking the next step in a new study, University ...ers have demonstrated the applicability of a genom...
(Date:12/1/2008)...ournal of the American Dietetic Association featu...ng habits of consumers. Researchers look at why fa...methods for adding healthier foods to a person,s d...Journal of the American Dietetic Association inclu... Reasons among Frequent Consumers, Menu Modeling ...
(Date:12/1/2008)...f sea and land animals around a group of Antarctic...sity and has more species than the Galapagos. The ...ow they will respond to future environmental chang...eography , the team from British Antarctic Survey ...d the land, sea and shores of the South Orkney Isl...
(Date:12/1/2008)...role in protecting us from diseases, but how does ...lden discovered that before dendritic cells move t...s helps them to move much faster. Immature dendrit... After exposure to such antigens they undergo a ri...the dendritic cells migrate to the lymph nodes to ...
Breaking Biology News(10 mins):Tool helps identify gene function in soybeans 2News from the December 2008 Journal of the American Dietetic Association 2Immune cells reveal fancy footwork 2Tolerance to inhalants may be caused by changes in gene expression 857 1Tolerance to inhalants may be caused by changes in gene expression 857 2Capps to Lead Bipartisan Womens Caucus Congressional Delegation to Represent United States at Women Deliver Conference in London 3933 1Capps to Lead Bipartisan Womens Caucus Congressional Delegation to Represent United States at Women Deliver Conference in London 3933 2Capps to Lead Bipartisan Womens Caucus Congressional Delegation to Represent United States at Women Deliver Conference in London 3933 3Jenny McCarthy Featured at National Autism Conference in Atlanta November 9 3931 1Jenny McCarthy Featured at National Autism Conference in Atlanta November 9 3931 2Greenway Medical Technologies Executive Testifies Before Congress 3929 1Greenway Medical Technologies Executive Testifies Before Congress 3929 2Greenway Medical Technologies Executive Testifies Before Congress 3929 3
Other Tagsretrieval 2eight 2eight 3eight 4eight 5eight 6eight 7eight 8eight 9eight 10surface 2surface 3surface 4surface 5surface 6surface 7surface 8surface 9surface 10
whopperstweakstelangiectasiaprimetimespectragyroscopeswooretrievaleightundiscoveredseethessurfacelaryngealanticholinergicsubwaycbs