Tag: "auxin" at biology news

Researchers discover chemical compounds that affect plant growth

..., while two of the four did not work through known auxin pathways. One of the chemicals resembled pyocyanin a product of bacterial metabolism thought to target yeast cell membranes. With chemical genomics, the team could identify valuable genetic characteristics beyond the reach of conventional mutations, ...

DFG awards 2005 Heinz Maier-Leibnitz Prize

...aves? Researchers have discovered that the hormone auxin regulates which parts of a plant are "upper" and which are "lower". Jiri Friml, who holds two doctoral degrees, has discovered that certain proteins direct the growth hormone to where it is required. The identification of these PIN proteins is a grou...

Scientists find microRNAs regulate plant development

...teins that regulate the expression of genes in the auxin response pathway. Messenger RNA (mRNA) molecules a...esponding to several regulatory genes that mediate auxin responses contain short stretches of sequence that are complementary to microRNAs, and therefore hav...

At long last, scientists figure out how plants grow

...ave known since 1885 that the plant growth hormone auxin exists. They've known of its dramatic effects on p... Kingdom report a virtually identical result. "How auxin works has been a holy grail in plant science," said Estelle, who led the research. "This was somethi...

Scientists discover genetic key to growing hardier, more productive plants

...sed to explain the transport of the plant hormone auxin for the last 30 years," Murphy said. "This model p... proton gradient should result in a faster rate of auxin transport. This theory never had been tested directly tested in plants where the proton gradient had...

Plant gene related to cancer treatment may foster new oncology drugs

...arently move molecules of the plant growth hormone auxin through cell walls. In humans, related proteins ri...xperimental plant Arabidopsis, directly transports auxin out of plant cells and also out of yeast and mammalian cells. In the Plant Cell study, they found th...

Max Planck researchers make a breakthrough in plant stem cell research

... The first involves growth-promoting hormones like auxin and cytokinin, known already for more than half a century. The second involves genetic factors, which were discovered at the University of Tübingen, Germany about a decade ago. Here it was shown that a gene called WUSCHEL has a key influence on how m...

Pleasing plant shapes explained by new computer model

...entrations of the fundamental plant growth hormone auxin appear at regularly-spaced intervals. This creates the striking spiral patterns of seeds observed in sunflowers, daisies, and many other plants. Other patterns, such as branching at right angles observed in lilac branching, can be also be simulated ...

Mark Estelle of Indiana University awarded Kumho International Science Prize

...es recentlyculminated in the identification of the auxin receptor by Estelle'sgroup and by Ottoline Leyser at the University of York. There had beenexhaustive, multi-year searches by laboratories across the globe forthis elusive finding. Upon being notified that Dr. Estelle had won the award, ASPB Presid...

Researchers offer clues to how leaf patterns are formed

...eral years it has been known that a hormone called auxin stimulated the formation of the veins. "It was believed that auxin would behave like man--build the streets on which man himself would travel," said Scarpella. "Howeve...

UC San Diego biologists solve plant growth hormone enigma

Gardeners and farmers have used the plant hormone auxin for decades, but how plants produce and distribute auxin has been a long-standing mystery. Now researchers at the University of California, San Diego have f...

UCSD biologists solve plant growth hormone enigma

Gardeners and farmers have used the plant hormone auxin for decades, but how plants produce and distribute auxin has been a long-standing mystery. Now researchers at the University of California, San Diego have f...

Discovery in plants suggests entirely new approach to treating human cancers

...f Cambridge have determined how a plant hormone -- auxin -- interacts with its hormone receptor, called TIR... known to be involved in cancer. "Learning that auxin regulates TIR1 is a huge advance for plant biology that will probably have important implications fo...

National awards for 2 University of York scientists

...opment. She has been researching the plant hormone auxin for 15 years, and has been a member of the Department of Biology at York since 1994. Part of the 30,000 award, must be spent on promoting women in science. Professor Leysers nomination stated that many women are deferred from pursing a career in sc...

Circadian clock controls plant growth hormone

The plant growth hormone auxin is controlled by circadian rhythms within the plan...Darwin conducted early experiments that showed how auxin affects plant growth. Most plants and animals have an internal clock that allows them to match their...

1

(Date:4/17/2014)... hundred births, Down syndrome - or trisomy 21 - ... It results from a chromosomal abnormality where cells of ... (1% of the human genome). A study conducted by ... Genetic Medicine and Development at the University of Geneva ... shed light on how the extra chromosome 21 upsets ...
(Date:4/17/2014)... Clemson professor Rajendra Singh Thursday as a "Champion ... expand solar deployment in the residential, commercial and ... Professor of Electrical and Computer Engineering and director ... a local hero leading the charge across the ... solar power and driving policy changes at the ...
(Date:4/17/2014)... such as heart disease, epilepsy and pain, making them ... is still much scientists do not know about the ... into the structure of sodium channels and, specifically, one ... responsible for ,fine-tuning, the activity of the channel. The ... the Journal of Biological Chemistry . , Nerves ...
Breaking Biology News(10 mins):Trisomy 21: How an extra little chromosome throws the entire genome off balance 2Trisomy 21: How an extra little chromosome throws the entire genome off balance 3White House honors Clemson professor as 'Champion of Change' for solar deployment 2Structure of sodium channels different than previously believed 2
Other Tags
architectsbeaverrunawaycaspaseclindamycinplentifulpertussisimmunogenicityallergenillnessessupplementsherbalprofessorshipbassetspaceddocument