Tag: "boy" at biology news

Acoustics meeting in San Diego

...d a pitch accent can be seen in the sentence, "The boy found a dollar." While the three words "boy," "found," and "dollar" all carry stressed syllables, the stressed syllable in "boy" and "dollar" receives a greater degree of stress, i.e., a pitch accent, than that in "found." Confirmed in three individ...

My favourite aunt is purple

...discovered in the 1930s documents a seven year old boy who also associated colours with people, but saw strangers in bright orange with a black outline which faded to a mild blue and finally pink when he got to know them. Dr Jamie Ward continues: "The ability of some people to see the coloured aur...

JCI table of contents, November 15 2004

New gene mutation found to cause "bubble boy disease" Approximately one in every million peopl...severe combined immunodeficiency (SCID) or "bubble boy disease". Characterized by inherited abnormal changes in B and T cells of their immune system, these...

New gene mutation found to cause 'bubble boy disease'

...severe combined immunodeficiency (SCID) or "bubble boy disease". Characterized by inherited abnormal chan...e 1970's when the world learned of David Vetter, a boy with SCID who lived for 12 years in a plastic, germ-free bubble. A number of genetic abnormalities c...

A startling diary reveals the onset of autism

...ifferent from his sister's. By the age of two, the boy had developed a fixation on particular patterns an...zles; at age three, a child psychologist noted the boy "did not offer comfort if others are in distress and will not come for comfort is he is hurt." The m...

Rapid, new test develped for inherited immune deficiency

...n Travolta -- about David, the Bubble Boy, a Texas boy who spent his entire life in a germ-free environment, ultimately dying after a failed bone marrow transplant in early adolescence. No one knows exactly how many babies are born with SCID. Current estimates suggest that 1 in every 50,000 to 100,000 bi...

Examining the serotonin transporter gene and family function

...id. "On the other hand, we know that if you are a boy and your father was an alcoholic, those factors alone multiply your risk almost nine-fold. If in addition you tolerate unusually high amounts of alcohol when you start drinking, your risk is even higher." Heilig acknowledged that identification of...

Newly discovered genetic disease sheds light on body's water balance

...thal and Feldman took blood samples from each baby boy and his mother to search for the cause of the uniq...nced the patients' AVPR2 genes and found that each boy had a unique mutation affecting the amino acid arginine at position 137 (R137). The single nucleotid...

Pediatric center to offer novel rehabilitation approach for spinal cord injury

...er for Spinal Cord Injury Van Brooks, 17-year-old boy paralyzed in Sept. 2004 during a football accident Joy Dobler, quadriplegic and wife of Conrad Dobler, former NFL All-Pro offensive guard Michael C. Manganiello, Christopher Reeve Paralysis Foundation Dr. Gary Goldstein, President and CEO, Kennedy...

Flip-flopped chromosome reveals a first clue to Tourette syndrome

... The researchers discovered one such instance in a boy who was the only member of his family with TS and who had a gene inversion on chromosome 13. Such inversions occur when a section of chromosome is broken off and flip-flops before reinserting itself back into the chromosome. Using chromosomal anomali...

UC Davis ophthalmologist to examine ancient Chilean mummy eyes

... medical conditions. One of the eyes belonged to a boy who was 2 years old when he died 1,000 years ago, and the other is from a female, who was approximately 23 years old when she died 750 years ago. "The opportunity to analyze two pre-Columbian era mummy eyes is exciting and fascinating," said Lloyd, a...

Genetic cause of speech defect discovered

...covery of a genetic abnormality in a nine-year-old boy with learning difficulties and speech problems fro...r chromosomes, the researchers discovered that the boy carries additional copies (termed duplication) of around 27 genes on chromosome 7. This is only the ...

Engineers discover why toucan beaks are models of lightweight strength

As a boy growing up in Brazil 40 years ago, Marc A. Meyers marveled at the lightweight toughness of toucan beaks that he occasionally found on the forest floor. Now a materials scientist and professor of mechanical and aerospace engineering at UCSD's Jacobs S...

Studies show benefits of newborn screening for 'bubble boy disease'

...der of the immune system commonly known as "bubble boy disease" -- is both cost-effective and could be done accurately using a two tiered testing method. "We wanted to determine whether testing for SCID should be added to the universal screening panel for genetic disorders," said Dr. Sean McGhee, clinica...

Americans prefer to leave child's sex to chance, survey finds

...ex of a child simply by taking a "blue pill" for a boy or a "pink pill" for a girl, only 18 percent of respondents indicated they would do so. The rest were opposed or undecided. "Perhaps this speaks to the fact that people still want to leave things up to chance and not rely on science for everything," ...

Male loons change their tune with change in territory

... "It's as if they are trying to say, 'I'm the new boy on the block,'" said the paper's lead author, Charles Walcott, professor of neurobiology and behavior at Cornell. "Why that should be important, we really don't know." The researchers recorded 527 yodels of 16 male loons on 21 lakes at the Seney Nati...

Minor mutations in avian flu virus increase chances of human infection

... originally isolated from a 10-year-old Vietnamese boy who died from the infection in 2004. The hemagglutinin (HA) structure from the Viet04 virus was found to be closely related to the 1918 virus HA, which caused some 50 million deaths worldwide. Using a recently developed microarray technology-hundred...

New gene reduces retinal degeneration in fruit flies

...the novel Lazarillo de Tormes, in which the orphan boy Lzaro helps a blind man see. Of the molecules known to control TRP channels, a key player is diacylglycerol, known as DAG. DAG is known to be made by a well-studied biochemical pathway. The researchers found that Lazaro provides a second way to make ...

Picking the best parent for your chicks

The local boy with the most bling is a good choice in the spring, but as summer progresses a girl bird's best bet is a stranger. Who's chosen by whom in the mating game is determined by seasonal changes in the genetic diversity of available mates, according to new...

New step toward treatment for Duchenne muscular dystrophy

...ar dystrophy is a hereditary disease affecting one boy in 3,500. The first signs appear in childhood, between the ages of two and five. Its victims are confined to a wheelchair by their early teens. The disease progressively weakens all muscles, notably respiratory muscles, compromising life expectancy. ...

1 2

(Date:5/17/2013)... Shenzhen, China---- Why Tibetan antelope can live at ... a collaborative research published in Nature Communications ... institutes provide evidence that some genetic factors may ... highland environments. The data in this work will ... and the biology of other ruminant species. , ...
(Date:5/17/2013)... team of scientists using a new X-ray method recorded ... frog embryo in greater detail than ever before., This ... and the search for new treatments for genetic diseases., ... Technologie in Germany, in collaboration with the Advanced Photon ... Laboratory, released the most precise depiction ever of the ...
(Date:5/16/2013)... fast food restaurant had a higher body mass index ... food, according to researchers at The University of Texas ... strong among those with a lower income. , ... Journal of Public Health indicates higher BMI associates ... among lower-income African-Americans, the density, or number, of fast ...
Breaking Biology News(10 mins):The genome sequence of Tibetan antelope sheds new light on high-altitude adaptation 2New X-ray method shows how frog embryos could help thwart disease 2Body mass index of low income African-Americans linked to proximity of fast food restaurants 2Body mass index of low income African-Americans linked to proximity of fast food restaurants 3
Other Tags
naturetoldentrepreneursrepellentsfiringmixesriboswitchespeekscryingnighttimechronicinfantsmaasiowacabonathan