Tag: "characterisation" at biology news

ESA's Huygens begins its final journey into the unknown

... extended mission will start, consisting in direct characterisation of Titan's surface for as long as the batteries can power the instruments and the Cassini orbiter is visible over the horizon at the landing site, i.e. not more than 130 minutes. At that time, the Cassini orbiter will reorient its main antenna di...

Theory on evolution of essential genes is overturned by new finding

...f a project to produce the first molecular genetic characterisation of a paternal effect gene. Paternal effect genes a...bject of scientific investigation, and the genetic characterisation of this gene will help further investigations in this area," said Dr Karr. "I would be very surprise...

Advances in the characterisation of the oyster mushroom genes

...rison with the corresponding genomic sequence, the characterisation of their structure. Regarding their location on the linkage map, it has been found that four of the five genes are located on the same chromosome, quite near each other, and the other is located on a different chromosome. It is precisely this fifth g...

Space measurements of carbon offer clearer view of Earth's climate future

...easurements of carbon flux, through better surface characterisation to the incorporation of the currently available satellite observations of carbon gases. More precise information of where on the surface CO2 is being removed or emitted would go a long way to shrinking areas of uncertainties within current models. H...

Don Quixote's home shows way to future Earth Observation missions

...ater fluxes from vegetation, along with a detailed characterisation of soil moisture and water motion in the soil. Such data is useful for properly modelling the water balance in relation to water management issues, and in particular is intended to validate results from a European Union-funded project called DEMETER...

Bioinsecticide for combating a pest that affects the tomato and the green bean

...he research team -, the biochemical and biological characterisation of the most specific strains of H. armigera found in the extensive collection of baculovirus available to the team will be undertaken. Then, those strains showing the best biological characteristics for their future development as bioinsecticides wil...

'EMBO Gold' goes to leading diabetes and cancer researcher

...in the world of cell signalling. His discovery and characterisation of the PDK1 and LKB1 kinases has had a major impact on understanding of signal transduction. These breakthroughs and Alessi's continued research in this area also hold great promise for the clinical treatment of inherited diseases. EMBO Executive Dir...

Important factors involved in the synthesis of starch in plants

... Nevertheless, in this PhD work the production and characterisation of bacteria with altered levels of GlgP have enabled an elucidation of the fundamental role of this enzyme, both in the breakdown of the glycogen and in the production of precursors for the synthesis of maltodextrines. Moreover, Nora Alonso conclude...

Genes involved in biofilms

... infections. The PhD, entitled Identification and characterisation of new factors involved in the processes of format...the author of the PhD. The aim of the PhD was the characterisation of the process of formation of the Staphylococcus aureus biofilm. Regulating mechanisms unknown t...

Dragon over water: Envisat monitors China's largest lake, rivers flooding

...th flood mitigation as well as improved ecological characterisation of the surrounding landscape. Accordingly a radar sensor aboard Envisat was used to regularly monitor the Lake during 2004 to 2005. Envisat's Advanced Synthetic Aperture Radar (ASAR) instrument records the signal reflectivity of the Earth's land, se...

Chemical warfare agent detection technology used to treat lung disease

...eed separations of complex mixtures and structural characterisation of pharmaceuticals and biomolecules....

Opportunities for structured doctoral research

...nt Light Sources" is dedicated to the development, characterisation and the use of modern radiation sources such as crystalline waveguide lasers, photonic fibre lasers, optical fs-lasers, free electron lasers, synchrotron radiation sources and atom lasers for light and matter waves. (Spokesperson: Professor Klaus Sen...

16 outstanding researchers receive Singapore's highest honor in science and technology

... End diTag sequencing technology for comprehensive characterisation of the human genome and transcriptome" Team c... End diTag sequencing technology for comprehensive characterisation of the human genome and transcriptome" The human genome sequence, which was completed in 2004, pr...

Sperm proteome gives 'tantalizing glimpse' towards the origin of sex

...his study marks the first substantial 'whole-cell' characterisation of the protein components of a higher eukaryotic cell (a cell in which all the genetic components are contained within a nucleus). This so-called 'proteome' contains everything the sperm needs to survive and function correctly, and scientists can u...

A vegetable fiber from tomato which can be used in making functional meat and bakery foods

.... AZTI- Tecnalia is targeting the obtaining and characterisation of new food bio-molecules based on novel sources. An example of this is obtaining fibre from the vegetable sub-products of the tomato canning industry. Exhaustive research using various techniques for the identifying of the chemical composition of t...

Chitin from lobster shell shows great healing and bio-stimulant properties

...ng industry and it goes on to cover these products characterisation through traditional techniques and some more innovative ones, the study of their properties, the development of new by-products and the testing of their practical applications in areas useful for this Caribbean country, such as agriculture and biomed...

The origin of perennial water-ice at the South Pole of Mars

... This was achieved thanks to the OMEGA mapping and characterisation of these ice deposits, combined with the computer-generated Martian Global Climate Models (GCMs). The mapping and spectral analysis by OMEGA has shown that the perennial deposits on the Martian South Pole are of essentially three types: water-ice...

A new method of adult stem cell growth efficacious in treatment of disorders of the cornea

...growth method lies in the fact that it enables the characterisation of the cells obtained, i.e. determining the quantity and viability of the units to be used. The method developed combines culture on a plastic chip with that of an amniotic membrane one. The novelty of the technique focuses on the first stage wher...

European Science Foundation's Forward Look reaches out beyond the endless frontiers

...tium with expertise in nanomaterials (manufacture, characterisation and standardisation) and the techniques needed to evaluate the potential risks of environmental, human exposure (accidental and purposeful) to the many emerging categories of nanomaterials. Systems Biology (completed in 2007, see also http:/...

1

(Date:8/21/2014)... , Aug. 21, 2014 /PRNewswire-iReach/ -- ... it has agreed to a partnership with Gabriel ... fastest growing Certified Nursing Assistant ... Health Institute  an exclusive member of Binary,s LiveScan ... Binary Biometrics will improve its service capabilities ...
(Date:8/21/2014)... Nine researchers from Beth Israel Deaconess Medical ... "The World,s Most Influential Scientific Minds 2014," ... Reuters ScienceWatch, a web resource for science metrics and ... as among the most influential "are performing and publishing ... advancement of their science," according to a Thomson Reuters ...
(Date:8/21/2014)... Mller the Fram Strait is a key region in the ... between Greenland and Svalbard warm Atlantic water flows to the ... cold Arctic water masses and sea ice push their way ... portion of the Atlantic water cools here on its way ... of the water caused in this manner drives the global ...
Breaking Biology News(10 mins):LiveScan Provider Binary Biometrics Announces Partnership with Preeminent CNA School, Gabriel Health Institute to Expand Services in Orlando Region 2LiveScan Provider Binary Biometrics Announces Partnership with Preeminent CNA School, Gabriel Health Institute to Expand Services in Orlando Region 3BIDMC researchers named among 'the most influential scientific minds' 2BIDMC researchers named among 'the most influential scientific minds' 3Arctic sea ice influenced force of the Gulf Stream 2Arctic sea ice influenced force of the Gulf Stream 3
Other Tags
circuitrythinkingmapsdeficitdyingdesertcardiometabolicdipregrowparametersmanagesscriptshandfulavertperversitydrills