Tag: "classical" at biology news

Gene found for rare disorder may reveal new pathway in mental retardation

...as missing hands or fingers, that are hallmarks of classical cases of CdLS. The genes play important roles in e...rsions of the distinctive facial features found in classical CdLS, such as thin eyebrows that join together, long eyelashes, thin lips and excessive body hair. ...

Genes behind animal growth discovered

...rid vigor to be more complicated than predicted by classical ideas in genetics and physiology. For example, some genes were expressed much less in the offspring than in either parent, a pattern the authors call "underdominance." Very few genes were expressed as the average of the expression in their parents...

The hitchhiker's guide to altruism -- Study explains how costly traits evolve

...ed to describe social evolution and recovering the classical results of kin selection theory. This insight raises the possibility of using the tools of hitchhiking theory to explore social problems that have so far been too complicated to analyze using traditional kin selection techniques....

Quantum biology -- Powerful computer models reveal key biological mechanism

...s researchers to do things that can't be done with classical physics, such as modeling the way chemical bonds break and form, or including the effect of proton "tunneling" -- allowing protons to move through energy barriers that normal logic would deem impossible. For this project, the researchers used compu...

Large size crucial for Amazon forest reserves

...f 55 bird species allowed an unprecedented test of classical scientific hypotheses about the effects of reserve size and isolation on the local extinction and colonization of species. The species-specific estimates of effects of area and isolation on extinction and colonization processes permit prediction of e...

TIGR researchers reveal tricks of common sexually transmitted infection

... a small group of eukaryotes that does not possess classical mitochondria. Instead it uses organelles known as hydrogenosomes to produce ATP and molecular hydrogen. T. vaginalis hydrogenosomes contain no genetic material, and their origins have been controversial. The researchers found evidence supporting a co...

Epigenetic drugs, promising for breast cancer treatment

...alterations are equally if not more important than classical genetic alterations to disrupt the function of tum...drugs can be safely administered concurrently with classical cytotoxic agents such as doxorubicin and cyclophosphamide, a common drug combination employed in the...

Leibniz Prize winners 2007 announced

... music with success, but then decided to switch to classical philology. After studying in Heidelberg and Oxford, he obtained his doctorate in Frankfurt, where he went on to qualify as a university lecturer in 1997. Following a brief interlude as lecturer at the University of Frankfurt, he accepted a chair at t...

'The Strangest Song' -- The story of the link between a rare genetic disorder and musical talent

...ert at Washington's Kennedy Center and a number of classical recordings. Lenhoff also helps establish the first residential college for mentally disabled musicians in Massachusetts. An inspiring blend of human interest and breakthrough science, The Strangest Song offers startling insights into the mysteries o...

CGIAR climate change research

...in low-moisture, high-heat areas. MAS accelerates classical breeding by locating desired genetic traits on the chromosomes, setting the stage for plant breeders to transfer those genes into popular but drought-susceptible varieties or, eventually, into other cereal crops. "Stay-green" genes delay the prematur...

NIH selects Purdue to use phi29 DNA packaging motor for National Nanomedicine Development Center

...ne is merging new nanoscale fabrication tools with classical synthetic methods and delicate biomolecular building blocks to create materials with unique biomedical properties." The nanomedicine center will employ these tools by adapting a viral motor to package therapeutic cargo within a drug-delivery system...

Freshwater snails are surprisingly fast-moving invaders

...cale, end up looking heterogeneous and patchy. The classical deterministic diffusion paradigm fails to incorporate this feature and ignores the random nature of long-distance colonization events. Taking the snails into account, Facon and Patrice David (Centre dEcologie Fonctionnelle et Evolutive, CNRS) have...

Scientists: New phylum sheds light on ancestor of animals, humans

...hree different countries, one that also integrates classical marine biology with modern genomic techniques....

Resistance and genetic sensitivity to sleeping sickness

...ow Glossina fuscipes gorged with blood affected by classical chronic forms of the disease; others bear severe rapidly developing forms; still other people show no symptoms of human African trypanosomiasis, in spite of a long period of infection. This diversity in host clinical presentation in reaction to infec...

Does missing gene point to nocturnal existence for early mammals?

...ere at one time wholly nocturnal creatures. "The classical view of how the eye sees is through photoreceptive cells in the retina called rods and cones," explained Dr Jim Bellingham, who led the research at The University of Manchester. "But, recently, a third photoreceptor was discovered that is activated...

Naked mole-rat unfazed by oxidative stress

...was greater in the kidney and liver. "All of the classical measures of oxidative stress are higher in the mole-rat," Andziak concluded. "Given that naked mole-rats live an order of magnitude longer than predicted based on their body size, our findings strongly suggest that mechanisms other than attenuated ox...

JCI table of contents: Oct. 5, 2006

...ies activate an immune system pathway known as the classical complement pathway. Transfer of antibodies specif...ase in mice lacking C4 (a crucial component of the classical complement pathway). In the absence of activation of the classical complement pathway, immune cells ...

Protein folding physics, nanohandles, sunscreen for algae and classical quantum weirdness

...sts on request) Applying techniques derived from classical and quantum physics calculations may radically red...hough the wave/droplet is clearly a denizen of the classical world, the experiment provides a clever analogue of quantum weirdness at a scale that is much easier...

Fight weeds with plant pathogens

...s used for managing weeds with plant pathogens-the classical biological control approach and the bioherbicides approach. The classical biocontrol approach uses a pathogen imported from a foreign location to control a native or naturali...

When biology gets 'Quirky,' scientists turn to math

...s are quirky. "Some of the graphs that come from classical biological reactions -- even simple ones -- indica...e an essential building block of DNA. In fact, a classical chemotherapy agent, methotrexate, is used to thwart the operation of DHFR so that the out-of-control...

1 2 3 4 5 6

(Date:6/17/2013)... 2013 An international team led by scientists at ... Institute and Albert Einstein College of Medicine of Yeshiva ... that attacks the tuberculosis (TB) bacterium in two different ... solve one of the major global health crises of ... strains," said Peter G. Schultz, the Scripps Family Chair ...
(Date:6/17/2013)... ST. LOUIS -- In research published in Biochemical ... describe a technology that can detect new, previously unknown ... for viruses even when doctors have not identified a ... , In the new approach, scientists use ... discover viruses. , Taking advantage of the complete deciphering ...
(Date:6/17/2013)... early onset of puberty in girls, a new clinical ... Endocrine Society,s 95th Annual Meeting in San Francisco. , ... 10 and 14. Boys undergo these changes later, usually ... is diagnosed in girls when sexual development begins before ... when these changes occur before age 9. , Recently, ...
Breaking Biology News(10 mins):New compound excels at killing persistent and drug-resistant tuberculosis 2New compound excels at killing persistent and drug-resistant tuberculosis 3New compound excels at killing persistent and drug-resistant tuberculosis 4Saint Louis University researchers discover a way to detect new viruses 2Saint Louis University researchers discover a way to detect new viruses 3Vitamin D supplementation may delay precocious puberty in girls 2
Other Tags
capillarymaterialisemisshapentacticsoupamchitkapassivelawnsstaraffirmsmelodyunbornregretbeverageassurefao