Tag: "closing" at biology news

Giant insects might reign if only there was more oxygen in the air

... a larger body. Insects can limit oxygen flow by closing their spiracles. In fact, one reason insects are so hardy is that they can close their spiracles and live off the oxygen they already have in their tracheae. Kaiser recalled a caterpillar that fell into a bucket of water in his lab. When the creature...

ESA's microsatellite playing major role in scientific studies

..., where dedicated sessions will be organised. In closing comments, the Proba community expressed hope that the spacecraft would last well beyond its 5-year anniversary next month in order to keep the science going until new missions with similar capabilities arrive....

One protein, two channels: Scientists explain mechanism in aquaporins

...sm gives us a new handle to control the opening or closing of the central pore," Tajkhorshid said. "By modifying the pore-lining residue, or altering the length of loop D that gates the pore, we can shut down the ion conductivity completely, or engineer new aquaporins that can be opened more easily or have a...

ActoGenix raises 11.5 million in series A stock financing

...iopharmaceutical company, announced the successful closing of its Series A financing round, raising 11.5 million (~US$15 million) from a syndicate of leading life sciences investors. The transaction was co-led by GIMV (Antwerp, Belgium) and Life Sciences Partners (LSP, Amsterdam, The Netherlands), with Biote...

Minnesota and Michigan reseachers discover new insights for antibiotic drug development

... first to crystallize an enzyme in the process of closing the antibiotic ring, which illustrates exactly how the ring is formed. Their work creates important opportunities for drug discovery to stay one step ahead of the superbugs. "Having the tools to make the next generation of macrolide antibiotics is ...

Trap-jaw ants have fastest recorded strike in animal kingdom

... "You'd think the relevant number is the mandible closing speed, but it's actually the acceleration that is most impressive," said Patek. "The acceleration is huge relative to the tiny mass of the mandibles. The mandibles are operating in the outer known limits in biology in terms of speed and acceleration....

Medical steroid's baffling connection to osteoporosis becomes clearer

Scientists are closing in on the solution to a persistent medical puzzle: why do high doses of cortisone, widely prescribed for asthma, rheumatoid arthritis and other inflammatory and autoimmune conditions, weaken bones? Through studies of mice, researchers at Washington...

ACS News Service Weekly PressPac -- July 19, 2006

...long-sought alternative to the traditional ways of closing incisions in the eye after cataract surgery. Mark W. Grinstaff and colleagues have synthesized and tested a new biocompatible adhesive gel that seals eye incisions quickly with the strength to keep the incisions sealed. Their report is scheduled for...

Protein tied to usher syndrome may be hearing's 'Missing Link'

... this structure may be responsible for opening and closing the channel gate. Researchers suggest that if they can learn the makeup of the tip link, they'll be that much closer to understanding how the gate mechanism operates. "This research identifies protocadherin-15 to be one of the proteins associated wi...

Smithsonian to coordinate planning for Panama's Coiba National Park/World Heritage Site

...versity. We want to keep it that way, but without closing it off to fishing, ecotourism and other sustainable activities," explains Dr. Juan Maté, STRI project coordinator. Coiba National Park forms part of the Eastern Pacific Marine Conservation Corridor composed of the Galapagos Islands (Ecuador), the Coc...

Research uncovers signaling pathways related to brain-immune system links

...end signals to turn off the CCR5 receptor for HIV, closing the door to the virus," said Dr. Douglas. "Underlying the signaling mechanisms are the questions, 'how does the immune system talk to the nervous system?' and 'how does the nervous system talk back?' Substance P is a link between both systems, and th...

Mutation in deafness gene can help heal wounds and prevent infection

...s communicate is through the regulated opening and closing of channels called gap junctions that link cells together. The main components of these channels are proteins called connexins, of which Cx26 is one. "When we looked at the function of Cx26 in a laboratory skin model", said Dr. Man, "we found that ...

UCSD study reveals how plants respond to elevated carbon dioxide

...dioxide in the atmosphere controls the opening and closing of leaf stomata--pores through which plants "breat...ds to changes within a plant cell that trigger the closing of the stomata--the breathing or gas exchange pores in the leaf surface." One of the standard argum...

Forsyth scientists gain greater understanding of how embryos differentiate left from right

...velopment. "Another exciting thought is that we're closing in on the symmetry breaking event," said Dany Adams, the paper's first author. According to Dr. Levin, this work shows a unified model for understanding embryonic development, and is therefore likely to provide important insight into human developmen...

African amphibians make extreme parental sacrifice: The skin off their backs

...against their mothers while repeatedly opening and closing their mouths. They used their lower jaws to lift and peel the outer layer of the mother's skin." Studies of the females' skin revealed that the outer layer is up to twice as thick in brooding females as in non-brooding females and is full of nutritio...

USC and AAAS/Science convene leading innovators to discuss challenges to US preeminence

...icting the future of artificial intelligence;" A closing discussion moderated by Chris Matthews , host of MSNBC's "Hardball with Chris Matthews," that will push the limits of the panel's knowledge, from the biological and social sciences to education and technology to the environment, to help reveal the a...

Avian flu modeled on supercomputer, explores vaccine and isolation options for thwarting a pandemic

...such as by travel restrictions, quarantine or even closing schools), but we find that these measures are useful in buying time to produce and distribute sufficient quantities of vaccine and antiviral drugs," said Germann of Los Alamos' Applied Physics Division. "Based on our results, combinations of mitigati...

Environmentalists' 'marine reserve' proposals misguided, report suggests

...d, Canada. Prof. Polunin said: "Evidence suggests closing off small areas of the ocean won't deliver results with regard to highly mobile species like cod and haddock. These fish, which are among the most economically sought-after species, may travel hundreds of miles to move between spawning and feeding ar...

Special issue of the Journal of Industrial Ecology focuses on eco-efficiency

...nvestment, and the eco-efficiency of advanced loop closing (recycling) techniques in Japan....

20th annual Society of Conservation Biology meeting

... will be notified within two to three weeks of the closing date. Journalists are eligible for free meeting registration and access to support services: contact 2006@conbio.org ....

1 2 3 4 5

(Date:8/21/2014)... , Aug. 21, 2014 /PRNewswire-iReach/ -- ... it has agreed to a partnership with Gabriel ... fastest growing Certified Nursing Assistant ... Health Institute  an exclusive member of Binary,s LiveScan ... Binary Biometrics will improve its service capabilities ...
(Date:8/21/2014)... Nine researchers from Beth Israel Deaconess Medical ... "The World,s Most Influential Scientific Minds 2014," ... Reuters ScienceWatch, a web resource for science metrics and ... as among the most influential "are performing and publishing ... advancement of their science," according to a Thomson Reuters ...
(Date:8/21/2014)... Mller the Fram Strait is a key region in the ... between Greenland and Svalbard warm Atlantic water flows to the ... cold Arctic water masses and sea ice push their way ... portion of the Atlantic water cools here on its way ... of the water caused in this manner drives the global ...
Breaking Biology News(10 mins):LiveScan Provider Binary Biometrics Announces Partnership with Preeminent CNA School, Gabriel Health Institute to Expand Services in Orlando Region 2LiveScan Provider Binary Biometrics Announces Partnership with Preeminent CNA School, Gabriel Health Institute to Expand Services in Orlando Region 3BIDMC researchers named among 'the most influential scientific minds' 2BIDMC researchers named among 'the most influential scientific minds' 3Arctic sea ice influenced force of the Gulf Stream 2Arctic sea ice influenced force of the Gulf Stream 3
Other Tags
circuitrythinkingmapsdeficitdyingdesertcardiometabolicdipregrowparametersmanagesscriptshandfulavertperversitydrills