Tag: "convulsant" at biology news

Common anti-convulsant drug may help slow the progression of dementia

Researchers have found that a common anticonvulsant drug improved cognitive function and appeared to restore nerve cells in the brains of patients with HIV-related dementia. The results of the Phase I clinical trial are published in the March issue of the scientific journal Neurology. ...... The University of Rochester School of Medicine and the University of Nebraska Medical Center collaborated...

Study finds anticonvulsant drug poses greater birth-defect risk than suspected

Use of the anticonvulsant drug valproate during pregnancy may pose a significantly great risk of birth defects than does use of other antiseizure medications. In the March 22 issue of Neurology, researchers from the North American AED (Antiepileptic Drug) Pregnancy Registry at Massachusetts General Hospital (MGH) report that women taking valproate alone had a fourfold increased risk of having a c...
(Date:8/28/2014)... -- Scientists have identified the developmental on-off switch for ... produce more than two-thirds of the world,s naturally derived ... to see whether it is possible to manipulate this ... , The study, appearing August 28 in Cell ... molecule called cyclic-di-GMP and a larger protein called BldD ...
(Date:8/28/2014)... method for measuring and imaging how quickly blood flows ... understand how drug abuse affects the brain, which may ... lead to better treatment options for recovering drug addicts. ... from Stony Brook University in New York, USA and ... in The Optical Society,s (OSA) open-access journal ...
(Date:8/28/2014)... the first person to alert the world to Global ... be captured and stored underground. He says that Carbon ... the best way to avoid global warming getting out ... (Columbia University, New York) made the call during his ... where 150 scientists are meeting to discuss Carbon Capture ...
Breaking Biology News(10 mins):Small molecule acts as on-off switch for nature's antibiotic factory 2Small molecule acts as on-off switch for nature's antibiotic factory 3This is your brain's blood vessels on drugs 2This is your brain's blood vessels on drugs 3Global warming pioneer calls for CO2 to be taken from atmosphere and stored underground 2
Other Tags
speedycootsovulationperimenopausalpeeksgenesystemsstrepasidewallsbumpdegradationimmunitiesbrandedpolymerpurduesexes