Tag: "curbs" at biology news

Plant size morphs dramatically as scientists tinker with outer layer

...o find out which part of the plant both drives and curbs growth: is it a shoot's outer waxy layer? Its inner layer studded with chloroplasts? Or the vascular system that moves nutrients and water? The answer could have great implications for modern agriculture, which desires a modern magical bean or two. ...

New clues to how major weight-loss drugs work

...etite and aid release of a protein called MSH that curbs appetite. To trace the effect of these two proteins downstream in the appetite-regulating pathway, the researchers analyzed the effects of various drugs that enhance or interfere with serotonin on feeding behavior in mice. They found that the drugs...

Infection 'alarm' yields clues to immune system behavior

...urs. These ailments might be helped by a drug that curbs inflammation by reducing the sensitivity of IKK. Still other diseases that are characterized by a weak inflammatory response might be helped by a drug that makes IKK even more sensitive to infection messages. The researchers believe their computer mo...

1

(Date:8/21/2014)... , Aug. 21, 2014 /PRNewswire-iReach/ -- ... it has agreed to a partnership with Gabriel ... fastest growing Certified Nursing Assistant ... Health Institute  an exclusive member of Binary,s LiveScan ... Binary Biometrics will improve its service capabilities ...
(Date:8/21/2014)... Nine researchers from Beth Israel Deaconess Medical ... "The World,s Most Influential Scientific Minds 2014," ... Reuters ScienceWatch, a web resource for science metrics and ... as among the most influential "are performing and publishing ... advancement of their science," according to a Thomson Reuters ...
(Date:8/21/2014)... Mller the Fram Strait is a key region in the ... between Greenland and Svalbard warm Atlantic water flows to the ... cold Arctic water masses and sea ice push their way ... portion of the Atlantic water cools here on its way ... of the water caused in this manner drives the global ...
Breaking Biology News(10 mins):LiveScan Provider Binary Biometrics Announces Partnership with Preeminent CNA School, Gabriel Health Institute to Expand Services in Orlando Region 2LiveScan Provider Binary Biometrics Announces Partnership with Preeminent CNA School, Gabriel Health Institute to Expand Services in Orlando Region 3BIDMC researchers named among 'the most influential scientific minds' 2BIDMC researchers named among 'the most influential scientific minds' 3Arctic sea ice influenced force of the Gulf Stream 2Arctic sea ice influenced force of the Gulf Stream 3
Other Tags
circuitrythinkingmapsdeficitdyingdesertcardiometabolicdipregrowparametersmanagesscriptshandfulavertperversitydrills