Tag: "curbs" at biology news

Plant size morphs dramatically as scientists tinker with outer layer

...o find out which part of the plant both drives and curbs growth: is it a shoot's outer waxy layer? Its inner layer studded with chloroplasts? Or the vascular system that moves nutrients and water? The answer could have great implications for modern agriculture, which desires a modern magical bean or two. ...

New clues to how major weight-loss drugs work

...etite and aid release of a protein called MSH that curbs appetite. To trace the effect of these two proteins downstream in the appetite-regulating pathway, the researchers analyzed the effects of various drugs that enhance or interfere with serotonin on feeding behavior in mice. They found that the drugs...

Infection 'alarm' yields clues to immune system behavior

...urs. These ailments might be helped by a drug that curbs inflammation by reducing the sensitivity of IKK. Still other diseases that are characterized by a weak inflammatory response might be helped by a drug that makes IKK even more sensitive to infection messages. The researchers believe their computer mo...

1

(Date:5/20/2013)... New research suggests that a compound abundant in the ... death. , By altering a very specific step ... into normal cells that die as scheduled. , One ... process that would cause them to die on a ... study in cells, led by Ohio State University researchers, ...
(Date:5/20/2013)... - A novel vaccine study from South ... that will be unveiled at the American Association of ... takes place Monday, May 20 - Wednesday, May 22 ... , "The main goal of a vaccine is to ... that causes the disease", explained Dr. Hemachand Tummala, assistant ...
(Date:5/20/2013)... USA New Geology articles posted ... 2013 cover a wide swath of geoscience subdisciplines, ... geophysics, and paleobotany. Locations studied include Siberia; the ... Alpi Apuane, Italy; Ukraine; Mars; and the Southeastern ... 1. Rubies, jadeite, and plate tectonics;, 2. The ...
Breaking Biology News(10 mins):The compound in the Mediterranean diet that makes cancer cells 'mortal' 2The compound in the Mediterranean diet that makes cancer cells 'mortal' 3Germ-fighting vaccine system makes great strides in delivery 2New in GEOLOGY: Gems, Darwin, Mars, Hemp, Snowball Earth, a Siberian Impact Crater, and More 2New in GEOLOGY: Gems, Darwin, Mars, Hemp, Snowball Earth, a Siberian Impact Crater, and More 3New in GEOLOGY: Gems, Darwin, Mars, Hemp, Snowball Earth, a Siberian Impact Crater, and More 4New in GEOLOGY: Gems, Darwin, Mars, Hemp, Snowball Earth, a Siberian Impact Crater, and More 5New in GEOLOGY: Gems, Darwin, Mars, Hemp, Snowball Earth, a Siberian Impact Crater, and More 6New in GEOLOGY: Gems, Darwin, Mars, Hemp, Snowball Earth, a Siberian Impact Crater, and More 7New in GEOLOGY: Gems, Darwin, Mars, Hemp, Snowball Earth, a Siberian Impact Crater, and More 8New in GEOLOGY: Gems, Darwin, Mars, Hemp, Snowball Earth, a Siberian Impact Crater, and More 9New in GEOLOGY: Gems, Darwin, Mars, Hemp, Snowball Earth, a Siberian Impact Crater, and More 10New in GEOLOGY: Gems, Darwin, Mars, Hemp, Snowball Earth, a Siberian Impact Crater, and More 11
Other Tags
confidentialitydisorderspsychiatricfindingtakecampaignsmediaasmsubarachnoidfetusesantherosclerosisathleticismzincinsertssalediscourages