Tag: "day" at biology news

NIH awards new $14.5 million, five-year grant to the Scripps Research Institute

...ation between protein structure and function. Some day scientists may be able to interpret and catalog the structures and functions of all the proteins in the human body, which will reveal a wealth of information on the biology of human health and disease. "Everybody feels that structural biology needs...

New biomaterials improve medical devices

... applications that will be discussed on the second day are drug-eluting cardiovascular stents, orthopaedic tissue engineering to repair or replace bone, and scaffolds that promote nerve regeneration. Dr. Fintan Steele of the Novartis Institutes for Biomedical Research will give an after-dinner talk on e...

New biosensor rapidly detects deadly foodborne pathogen

...sensor so a sample can be processed in one working day and be monitored remotely via computer. "Our end goal is to use this technology to keep Listeria monocytogenes-tainted foods out of the food supply," Bhunia said. "To do this, we will continue to develop ways to make this device ...

September/October 2004 Annals of Family Medicine tip sheet

...ant proportion of elders experienced night sweats, day sweats and hot flashes. The authors suggest that the presence of these symptoms should prompt additional questions about febrile illnesses, diabetes, anxiety, depression, somatic and visceral pain, sensory deficits, and restless legs syndrome in addi...

Brain circuit may permit scientists to eavesdrop on memory formation

...platform. When the researchers tested the rats the day after the electrical lesions were made, they still recalled the platform's location. But they lost that memory four weeks after training. "There were two possible explanations for this result," said Schuman. "Either we had selectively impaired the pr...

Viruses found in untreated city water

...ered an average of 12 million gallons of water per day to its customers. ...

Researchers find chemosignal that encourages women's sexual desire

...the morning and at night and any other time of the day in which they may have wiped their upper lips, showered or exercised. The women with partners were asked about their moods and were asked to complete daily a survey with a scale indicating "the degree you felt desire today for sexual intimac...

Story tips from the Department of Energy's Oak Ridge National Laboratory, October 2004

...ficial cells and manmade interfaces that could one day be used to treat diseases and perform other tasks at the cellular level. In a paper to be published in an upcoming issue of Nano Letters, Mitch Doktycz and colleagues at ORNL and the University of Tennessee outline a system of microarrays of vertical...

Acoustics meeting in San Diego

... The first number of the paper code indicates the day of the talk, with "1" denoting Monday (November 15),"2" denoting Tuesday (November 16), and so on, up to "5" for Friday (November 19). POTENTIAL EXPLANATION FOR MARINE MAMMAL STRAGRONDINGS The mysterious beachings of whales following naval e...

Technique for genetically modifying blood stem cells brings cure for blood diseases closer

...ically modified by the gamma-globin gene could one day offer patients with hemoglobin diseases the promise of a cure," Persons said. Other authors of this paper are Phillip W. Hargrove, Steven Kepes, Deo K. Srivastava, and Arthur W. Nienhuis. ...

Health, food, new technologies featured during ACS meeting Oct. 17-20 in Peoria, Ill.

...fructose corn syrup and other sweeteners could one day get a fresh makeover using honey, researchers say. Scientists at the University of Illinois in Urbana say the ancient sweetener may be a healthier alternative than corn syrup due to its higher level of antioxidants, compounds which are believed to fi...

Channel protein converts vibrations to electrical signal

...tive when the embryo was about 16 days old just a day before hair cells become mechanically sensitive. Next, the scientists looked for TRPA1 within the hair cell. In frogs and mice, a fluorescently-tagged TRPA1 antibody bound the tips of the cilia, where the mechanically activated channels were known...

Flies have morning and evening clocks

... the morning and evening, with a siesta during the day and not very much activity at night," he said. "There are several ways to explain that, but one possibility was that there were two clocks running -- one governing the morning peak and one governing the evening peak." Rosbash and his colleagues theo...

Laboratory test of evolutionary theory confirms importance of links between populations

...microbes that go through about ten generations per day in the laboratory, we were able to track evolutionary changes through time and answer questions that previously had only been addressed theoretically," said Samantha Forde, a postdoctoral researcher at the University of California, Santa Cruz, and fi...

Arctic mystery no longer: Dinosaurs walked Canada's great north

...tinues Larsson, who walked up to 25 kilometres per day for one month with his research team to locate bones during the summer of 2003 and 2004. "You wouldn't expect it, yet dinosaurs and a great variety of plants lived in the High Arctic 240 to 65 million years ago." These were Larsson's first Arctic exp...

Mini-Mouse is a bad mom

...parenting skills cause their young to die within a day or two of birth, scientists report this week in th...ng, or tend to their offspring, which die within a day or two as a result. "Basically, we observed mothers that don't care for their pups," says post-d...

An old adage about apples finds scientific backing

...TTLE -- To paraphrase an old adage: Can an apple a day keep colon cancer at bay? According to a new s...ls, suggesting such knowledge might be used to one day combat specific tumor growth, such as colon cancer. "For now, our work suggests that eati...

Biomedical engineers at case develop first sliver-sized sensor to monitor glucose levels

...medical engineer, got a splinter in his finger one day at least for the sake of science. With apologies ...to take samples from their fingers several times a day to monitor blood sugar levels," Gratzl said. "The monitor could also help doctors with close monitor...

Manipulation of epigenome turns off as many genes as it turns on

...the effects of this agent were similar at both one day and five days after treatment, the researchers suggest the agent might have a more direct effect than previously thought. Methylation of genes is an example of epigenetics, which are inheritable modifications to chromosomes and genes other t...

Consuming fruits and vegetables lowers risk of developing NHL

... consumed three or more servings of vegetables per day (not including potatoes) had a 40 percent lower r...e particularly strong for one or more servings per day of green leafy vegetables and one half or more servings per day of vegetables from the broccoli and ...

1 2 3 4 5 6 7 8 9 10

(Date:5/20/2013)... New research suggests that a compound abundant in the ... death. , By altering a very specific step ... into normal cells that die as scheduled. , One ... process that would cause them to die on a ... study in cells, led by Ohio State University researchers, ...
(Date:5/20/2013)... - A novel vaccine study from South ... that will be unveiled at the American Association of ... takes place Monday, May 20 - Wednesday, May 22 ... , "The main goal of a vaccine is to ... that causes the disease", explained Dr. Hemachand Tummala, assistant ...
(Date:5/20/2013)... USA New Geology articles posted ... 2013 cover a wide swath of geoscience subdisciplines, ... geophysics, and paleobotany. Locations studied include Siberia; the ... Alpi Apuane, Italy; Ukraine; Mars; and the Southeastern ... 1. Rubies, jadeite, and plate tectonics;, 2. The ...
Breaking Biology News(10 mins):The compound in the Mediterranean diet that makes cancer cells 'mortal' 2The compound in the Mediterranean diet that makes cancer cells 'mortal' 3Germ-fighting vaccine system makes great strides in delivery 2New in GEOLOGY: Gems, Darwin, Mars, Hemp, Snowball Earth, a Siberian Impact Crater, and More 2New in GEOLOGY: Gems, Darwin, Mars, Hemp, Snowball Earth, a Siberian Impact Crater, and More 3New in GEOLOGY: Gems, Darwin, Mars, Hemp, Snowball Earth, a Siberian Impact Crater, and More 4New in GEOLOGY: Gems, Darwin, Mars, Hemp, Snowball Earth, a Siberian Impact Crater, and More 5New in GEOLOGY: Gems, Darwin, Mars, Hemp, Snowball Earth, a Siberian Impact Crater, and More 6New in GEOLOGY: Gems, Darwin, Mars, Hemp, Snowball Earth, a Siberian Impact Crater, and More 7New in GEOLOGY: Gems, Darwin, Mars, Hemp, Snowball Earth, a Siberian Impact Crater, and More 8New in GEOLOGY: Gems, Darwin, Mars, Hemp, Snowball Earth, a Siberian Impact Crater, and More 9New in GEOLOGY: Gems, Darwin, Mars, Hemp, Snowball Earth, a Siberian Impact Crater, and More 10New in GEOLOGY: Gems, Darwin, Mars, Hemp, Snowball Earth, a Siberian Impact Crater, and More 11
Other Tags
confidentialitydisorderspsychiatricfindingtakecampaignsmediaasmsubarachnoidfetusesantherosclerosisathleticismzincinsertssalediscourages