The Latest Biology News And Medical NewsBiology News 2Health News 2Biology News 3Health News 3


Tag: "degradation" at biology news

New model of p53 regulation proposed that suggests novel anticancer strategy

... to heightened expression of Mdm2, which increases degradation of Mdm4 - freeing p53 to function unhindered - at the same time keeping p53 from going overboard. "This is a very elegant system, because it acts to titrate p53, giving the cell time to repair its DNA and to gauge how much damage there really is," Wa...

Inhibition of iron-metabolizing enzyme reduces tumor growth

...ilirubinemia to rapidly and predictably block heme degradation and prevent severe jaundice without significant short- or long-term side effects. This is very important because it shows that the inhibitor has been successfully used in human clinical trials to treat diseases in which heme oxygenase-1 is involved."...

Sludge recycling sends antiseptic soap ingredient to agriculture

...rage period of almost three weeks, yet very little degradation took place." Senior author Rolf U. Halden, PhD, as...ng with the treated effluent. However, very little degradation of the triclocarban occurred, due to the compound's polychlorinated aromatic chemical structure. App...

Targeted virus compels cancer cells to eat themselves

...ophagy have little damage to the nucleus but heavy degradation of the cells' organelles. Apoptosis and autophagy should be viewed as type 1 and type 2 versions of programmed cell death, Kondo says. In a Nature Reviews Cancer paper last September, Kondo and colleagues reviewed therapies and molecules that cause ...

Improvement of the treatments against brucellosis and ovine salmonella

... of existing products and avoid the denaturing and degradation which is suffered in the intestinal tract of sheep when vaccines are applied via the traditional oral method. Infertility and mortality in sheep This improvement in the treatment of brucellosis and ovine salmonella will mean an important advance in...

ACS weekly press package April 24th, 2006

...rain enzyme called aspartoacylase. This results in degradation of the myelin sheath that insulates the axons to allow efficient transmission of nerve impulses in the brain. Consequently, the infants carrying these mutations fail to develop, leading to blindness, lack of muscle control, mental retardation and eve...

Gene linked to rare disease activates fat breakdown

...t biochemical function for CGI-58 in the lipolytic degradation of fat, implicating this lipolysis activator in th...sruption of the equilibrium of lipid synthesis and degradation can result in prevalent metabolic diseases, such as obesity and type 2 diabetes, the findings might ...

News tips from The Journal of Neuroscience

...quitination of cyclin D1, thereby targeting it for degradation and blunting its proliferative effects. Overexpression of cyclin D1 increased NSC proliferation and offset the effect of Dex....

Gold nanoparticles could improve antisense cancer drugs

... and protein production), were less susceptible to degradation resulting in longer lifetimes, exhibited lower toxicity and were more readily absorbed by cells, exhibiting a greater than 99 percent uptake. "When mutations in the body's genetic material cause too many copies of certain proteins, cancer and other ...

DOE JGI finishes 100th microbial genome

...o ethanol; potential to oxidize products of lignin degradation and plays a role in cellulose degradation. Saccharophagus degradans 2-40. (formerly Microbulbifer degradans) Ronald Weiner, University of Maryland. Marine microbe degrades and recycles insoluble complex polysaccharides; potential for conversion of ...

Key stress protein linked to toxicities responsible for Parkinson's, Alzheimer's

...unction. Defects in either the protein folding or degradation pathways can lead to accumulation of misfolded proteins. The accumulation of misfolded proteins is a common pathogenic mechanism in many diseases, including neurodegenerative disorders. In normal circumstances, PDI levels increase in response to ac...

Research suggests cause of neurodegeneration in Huntington's disease

...its trafficking function. HAP1 cannot prevent the degradation of TrkA. The insufficient amount of TrkA cannot maintain the normal function of nerve terminals. Although the discovery that HAP1 works as a transporter and plays a crucial role in neuronal function was obtained from cell models, it will assist sci...

Researchers offer new insights on arid, semiarid landscapes

...ication, which can result in the loss of grass and degradation of soil as grasslands are converted into woody-plant-dominated landscapes. Although many research methods exist to study various facets of this process, more complete understanding of desertification can be achieved by looking back in time at histori...

A new way to build bone

...tipped." This imbalance between bone formation and degradation could potentially be recreated by drug treatments for osteoporosis, Crabtree said. Very little NFATc1 must be activated to build extra bone, Winslow noted, which means that it may be possible to up-regulate the calcineurin/NFATc pathway to promote bo...

New materials developed for vascular graft

...taking place. The PDO-elastin blend undergoes slow degradation and causes few adverse reactions compared with previous materials used for the same purpose, he said. The purpose of the new material would be to help a patient regenerate a new artery. If it works as designed the researchers hope that at six months ...

'Madagascar Declaration' focuses African development policies on value of nature

...cape from hunger, poverty and disease if ecosystem degradation continues at the current rate." The five-day confe...ss community in seeking solutions to environmental degradation caused by industrial development; and, prioritizing sustainable agriculture practices and alternat...

Carnegie Mellon, USDA report that Fe-TAML catalysts degrade estrogenic compounds

...h control pills -- is resistant to most biological degradation processes, but Fe-TAML activators break down more than 95 percent of this chemical within five minutes. "Our next step would be to advance testing to the field. Fe-TAML activators have been field-tested in the pulp and paper industry and textile in...

Tips from The Journal of Neuroscience

...P (C terminus of the Hsc70-interacting protein) in degradation of phosphorylated tau. In CHIP -/- mice, about half of the knock-out mice showed motor deficits and small size. These symptomatic knock-out mice had elevated tau levels and thus were used for the experiments. In these mice, there was an accumulation...

Celiac success: New enzyme efficiently degrades gluten in 'human stomach' environment

...l supplementation with an enzyme can ensure gluten degradation in the stomach before reaching the small intestine... on its work. The paper, "Highly efficient gluten degradation with a newly identified prolyl endoprotease: implications for celiac disease," is in the online Amer...

miRNA-mediated silencing of mRNAs

... miRNA effector Argonaute proteins as well as mRNA degradation enzymes, to promote target mRNA decay. The authors establish that GW182 functions downstream of the Argonaute-1 protein in the miRNA pathway, targeting transcripts for decay via a deadenylation and decapping reaction. The question of whether miRNA...

1 2 3 4 5 6 7 8 9 10

(Date:12/1/2008)...ineered crops, sequencing the genome could be cons...e sequence is complete, the baton is passed forwar...raft sequence of the soybean genome is now availab.... Taking the next step in a new study, University ...ers have demonstrated the applicability of a genom...
(Date:12/1/2008)...ournal of the American Dietetic Association featu...ng habits of consumers. Researchers look at why fa...methods for adding healthier foods to a person,s d...Journal of the American Dietetic Association inclu... Reasons among Frequent Consumers, Menu Modeling ...
(Date:12/1/2008)...f sea and land animals around a group of Antarctic...sity and has more species than the Galapagos. The ...ow they will respond to future environmental chang...eography , the team from British Antarctic Survey ...d the land, sea and shores of the South Orkney Isl...
(Date:12/1/2008)...role in protecting us from diseases, but how does ...lden discovered that before dendritic cells move t...s helps them to move much faster. Immature dendrit... After exposure to such antigens they undergo a ri...the dendritic cells migrate to the lymph nodes to ...
Breaking Biology News(10 mins):Tool helps identify gene function in soybeans 2News from the December 2008 Journal of the American Dietetic Association 2Immune cells reveal fancy footwork 2Tolerance to inhalants may be caused by changes in gene expression 857 1Tolerance to inhalants may be caused by changes in gene expression 857 2Capps to Lead Bipartisan Womens Caucus Congressional Delegation to Represent United States at Women Deliver Conference in London 3933 1Capps to Lead Bipartisan Womens Caucus Congressional Delegation to Represent United States at Women Deliver Conference in London 3933 2Capps to Lead Bipartisan Womens Caucus Congressional Delegation to Represent United States at Women Deliver Conference in London 3933 3Jenny McCarthy Featured at National Autism Conference in Atlanta November 9 3931 1Jenny McCarthy Featured at National Autism Conference in Atlanta November 9 3931 2Greenway Medical Technologies Executive Testifies Before Congress 3929 1Greenway Medical Technologies Executive Testifies Before Congress 3929 2Greenway Medical Technologies Executive Testifies Before Congress 3929 3
Other Tagsretrieval 2eight 2eight 3eight 4eight 5eight 6eight 7eight 8eight 9eight 10surface 2surface 3surface 4surface 5surface 6surface 7surface 8surface 9surface 10
whopperstweakstelangiectasiaprimetimespectragyroscopeswooretrievaleightundiscoveredseethessurfacelaryngealanticholinergicsubwaycbs