The Latest Biology News And Medical NewsBiology News 2Health News 2Biology News 3Health News 3


Tag: "demonstrated" at biology news

Biological importance of basal activity of appetite suppressor

...Deletion of the N-ter-minal portion of the protein demonstrated that it is required for this basal activity. Further analysis proved that this domain func-tions as an intermolecular self-activating ligand that does not mimic manner in which a-MHC activates MC4R. The work here suggests that in devising therapies f...

Antibiotic identified as potential anti-cancer candidate

...ss of new actinonin-based Pdf inhibitors, and have demonstrated that they selectively inhibit growth in several human tumor cell lines. They further demonstrate that human tumor growth in mice can be suppressed by these Pdf inhibitors and suggest a mechanism of actinonin action. Taken together, these data have ...

S1P1 essential for tumor growth and is blocked by RNA interference

...gosine 1phosphate receptor-1 in tumor angiogenesis demonstrated by in vivo RNA interference AUTHOR CONTACT: Timothy Hla University of Connecticut Health Center, Farmington, CT 06030, USA Phone: (860) 679-4128; Fax: (860) 679-1201; E-mail: hla@nso2.uchc.edu View the PDF of this article at: http://www.jci.org/...

Mice thrive despite massive genetic makeover

...te (JGI) and Lawrence Berkeley National Laboratory demonstrated that, after deleting large swaths of DNA sequence shared by mice and humans, they were still able to generate mice that suffered no apparent ills from their genomes being millions of letters lighter. The research findings are published in the Octo...

Single genetic defect links many risk factors for heart disease and stroke

For the first time, researchers have demonstrated that a single change in a person's DNA can contribute to a range of life-shortening risk factors, including high blood pressure, high cholesterol, and other metabolic disorders. The mutation affects the genes of the mitochondria the energy-producin...

Three years of Proba, the 'smart' satellite that runs itself

...oba Project Manager. "The mission has successfully demonstrated a number of sophisticated technologies in addition to new approaches in spacecraft construction and operations. "It has 100% lived-up to its full name of 'Project for On-Board Autonomy' for every day of the last three years the spacecraft performed...

Brain differences in adolescents, psychopaths, lend to their impulsive, risk-taking behavior

...and pleasure. Consistent with this view, the model demonstrated that when the rewards were administered in an unpr...provoking areas than prepubescent rats. Adult rats demonstrated similar extension behaviors, but did not enter the anxiety-provoking areas, while the pubescent anim...

Pesticides may promote Parkinson's disease and exercise may offer protection

...ing builds upon their previous study in which they demonstrated that rotenone, a commonly used agricultural pesticide made from the extracts of tropical plants, can reproduce parkinsonian features in rats. "Monkeys have a brain structure that is much more similar to humans than rats," notes J. Timothy Greenamyre...

Study at Joslin shows ease of introducing technology to kids with diabetes

... encouraged by the results of this pilot study. It demonstrated the ease of introducing new technology to pediatric patients with diabetes, with an additional benefit of increased blood glucose monitoring among the Game Group participants," Dr. Laffel said. ...

Children's Hospital Boston geneticist awarded for research on muscular dystrophy

...d muscle protein, dystrophin. In the 1990s, Kunkel demonstrated that injection of either blood stem cells or muscle stem cells can partially restore dystrophin in affected skeletal muscles, a finding that may lead to treatments for many types of muscle disease. More recently, Kunkel has defined the molecular and ...

Emory study details dolphin brain evolution for the first time

...n addition to their large brains, odontocetes have demonstrated behavioral faculties previously only ascribed to humans and, to some extent, other great apes. These abilities include mirror self-recognition, the comprehension of artificial, symbol-based communication systems and abstract concepts, and the learnin...

Gene therapy approach reverses diabetic neuropathy in animal model, Pitt study finds

...e University of Pittsburgh School of Medicine have demonstrated for the first time that gene therapy can reverse diabetic neuropathy. While their studies have so far only involved mice, the results are significant because they provide the earliest evidence that such an approach might some day help people with dia...

Moffitt doctor's talk on ovarian cancer receives international first place award

...lysis. Data obtained from cancers of patients who demonstrated a complete response to platinum-based therapy was compared with those from patients who did not respond. At the IGCS conference, leaders from around the world came together to examine current issues surrounding gynecologic cancer. Members had the ...

Humans and dolphins: If brain size is a measure, we're not that different

...n the animals' lifestyles. Odontocetes have demonstrated behavioral faculties previously only ascribed to humans and other great apes. These abilities include mirror self-recognition, the comprehension of artificial, symbol-based communication systems and abstract concepts, and the learning and intergenera...

Paratek Pharmaceuticals presents multiple sclerosis data at Society for Neuroscience annual meeting

...y Dr. Luanne Metz at the University of Calgary has demonstrated disease protection in MS patients treated with min...tetracycline compounds, with different structures, demonstrated activity in reducing limb paralysis in the preclinical EAE (Experimental Autoimmune Encephalomyeliti...

VYTORIN (TM) superior again to Lipitor at lowering LDL (bad) cholesterol

... not take VYTORIN. Study results also demonstrated VYTORIN increased HDL cholesterol by a greater deg...veraged across all doses, both VYTORIN and Lipitor demonstrated a mean 25 percent reduction on CRP after six weeks of treatment. "In addi...

Is the zebra fish leading us to new therapies?

...molecule receptor for nerve cells, the researchers demonstrated that zebra fish that are unable to produce UNC5B construct a blood vessel network with uncontrolled branches and divergent patterns. This indicates that the receptor and the signal molecule are of crucial importance in guiding new blood vessels. Scie...

Researchers tracking sources of arsenic contamination in water

...merica in Denver Nov. 7-10. Since health data have demonstrated that arsenic is a carcinogen, the U.S. standard for arsenic in drinking water has been lowered from 50 to 10 parts per billion, which is the same as the European Union standard, said Madeline Schreiber, assistant professor of geosciences. She and ass...

Antibiotic-resistant bacteria increased after clindamycin use for common vaginal infection

...ewer than 1 percent of bacterial samples we tested demonstrated resistance to metronidazole," said Dr. Beigi. "In contrast, 12 percent demonstrated baseline clindamycin resistance, and 53 percent demonstrated resistance to clindamycin after therapy...

Safety and immunogenicity data available for new pertussis booster vaccine candidate for adolescents

...ed] in whom efficacy against pertussis disease was demonstrated in a previous study. Currently, pertussis vaccination in the U.S. is only approved for children under the age of seven. Immunity from childhood vaccination generally wears off after five to 10 years, leaving many adolescents susceptible to this hig...

1 2 3 4 5 6 7 8 9 10

(Date:12/1/2008)...ineered crops, sequencing the genome could be cons...e sequence is complete, the baton is passed forwar...raft sequence of the soybean genome is now availab.... Taking the next step in a new study, University ...ers have demonstrated the applicability of a genom...
(Date:12/1/2008)...ournal of the American Dietetic Association featu...ng habits of consumers. Researchers look at why fa...methods for adding healthier foods to a person,s d...Journal of the American Dietetic Association inclu... Reasons among Frequent Consumers, Menu Modeling ...
(Date:12/1/2008)...f sea and land animals around a group of Antarctic...sity and has more species than the Galapagos. The ...ow they will respond to future environmental chang...eography , the team from British Antarctic Survey ...d the land, sea and shores of the South Orkney Isl...
(Date:12/1/2008)...role in protecting us from diseases, but how does ...lden discovered that before dendritic cells move t...s helps them to move much faster. Immature dendrit... After exposure to such antigens they undergo a ri...the dendritic cells migrate to the lymph nodes to ...
Breaking Biology News(10 mins):Tool helps identify gene function in soybeans 2News from the December 2008 Journal of the American Dietetic Association 2Immune cells reveal fancy footwork 2Tolerance to inhalants may be caused by changes in gene expression 857 1Tolerance to inhalants may be caused by changes in gene expression 857 2Capps to Lead Bipartisan Womens Caucus Congressional Delegation to Represent United States at Women Deliver Conference in London 3933 1Capps to Lead Bipartisan Womens Caucus Congressional Delegation to Represent United States at Women Deliver Conference in London 3933 2Capps to Lead Bipartisan Womens Caucus Congressional Delegation to Represent United States at Women Deliver Conference in London 3933 3Jenny McCarthy Featured at National Autism Conference in Atlanta November 9 3931 1Jenny McCarthy Featured at National Autism Conference in Atlanta November 9 3931 2Greenway Medical Technologies Executive Testifies Before Congress 3929 1Greenway Medical Technologies Executive Testifies Before Congress 3929 2Greenway Medical Technologies Executive Testifies Before Congress 3929 3
Other Tagsretrieval 2eight 2eight 3eight 4eight 5eight 6eight 7eight 8eight 9eight 10surface 2surface 3surface 4surface 5surface 6surface 7surface 8surface 9surface 10
whopperstweakstelangiectasiaprimetimespectragyroscopeswooretrievaleightundiscoveredseethessurfacelaryngealanticholinergicsubwaycbs