The Latest Biology News And Medical NewsBiology News 2Health News 2Biology News 3Health News 3


Tag: "discuss" at biology news

AACR-NCI-EORTC international conference

...ecular Targets and Cancer Therapeutics to present, discuss and hear about such promising discoveries as: A novel pancreatic vaccine appears to be nudging survival rates higher for this often-fatal disease. Researchers are reporting a significant bump over historical survival statistics in patients following ...

Allied health professionals meet at IOF World Congress on Osteoporosis

...c Committee. Presenters for this session, who will discuss management of patients with osteoporosis from an allied health professional perspective include: Ina Radziunas, Canada (nursing) Prof. Susan Barr, Canada (dietetics) Dr. Darien Lazowski-Fraher, Canada (physiotherapy) Azeena Ratansi, Canada (occup...

Low-income pregnant Latinas drink despite universal alcohol-warning messages

..." O'Connor concurs, and also adds that "we need to discuss the fact that rates of drinking have increased among pregnant women in general. We as researchers need to go beyond asking 'did they drink, or did they not drink?' and look at demographic and social/emotional variables as predictors. For example, w...

Two genetic traits giving Africans malaria protection lose effectiveness when they occur together

...site, will give a keynote address at MIM that will discuss how genomic data is advancing malaria research and what's needed to realize its full potential. (Tuesday, 9:00 a.m., Bubinga Hall, Plenary Session I, Keynote Lecture) For example, thanks to the genome sequence, researchers now have in their hands po...

Scientists find more evidence of resistance to once effective malaria drugs

...Center for Medical Parasitology in Copenhagen will discuss a study that found evidence in blood samples taken in two villages in northern Tanzania of a genetic variation in the malaria parasite that may be associated with an ability to resist amodiaquine (AQ), which is sometimes used in combination with arte...

New study finds malaria could play key role in mother-to-child transmission of HIV in pregnancy

...e Tropical Diseases Research Centre in Zambia will discuss a study on the use of intermittent preventive trea... Mudambo of Zimbabwe Military Health Services will discuss research looking at the extent to which being HIV positive causes severe complications and poor resp...

The Origin, Evolution, and Future of Life on Earth

...phy, science and religion. Five prominent scholars discuss these important questions about the past and the future of life on earth. Participants: Christian de Duve, 1974 Nobel Prize winner in medicine; author of Singularities (Publication date: September 2005 Colin McGinn, Philosopher (consciousness, int...

Scientists evaluate impact of preemptive malaria treatment for infants

...ance of long-term sustainability. Researchers will discuss these topics at a special IPTi symposium to be hel...ria. The MIM symposium is a timely opportunity to discuss the results from the Ghana trial and other IPTi studies with the international malaria research and ...

Methodist Neurological Institute, University of Houston combine 'brain power'

... a two-day Neuroscience Colloquium, Nov. 28-29, to discuss possible collaborations on research projects that could one day lead to treatments for neurological diseases and disorders, such as Alzheimer's, Parkinson's, brain aneurysms and more. "Medical science is in the midst of an explosion of knowledge abo...

Evolution: Constant Change and Common Threads

...C., area high school students, the scientists will discuss how Charles Darwin's fundamental concepts about evolution ignited a revolution in biology that continues to this day. The lectures will be Webcast live to classrooms around the world. The great extent of shared developmental machinery reveals a dee...

You can't rely on firearms forensics

...ve and standardise the tests. The bureau would not discuss the meeting, but special agent Ann Todd says the FBI's laboratory is preparing a paper for publication that "will make recommendations to the scientific community regarding accepting, conducting and interpreting GSR exams". Singer maintains that the ...

Experts join forces in bid to combat CJD and BSE

...to meet in Edinburgh today, Friday, 25 November to discuss the latest developments in the battle against Transmissible Spongiform Encephalopathies (TSEs) which include both BSE and variant CJD. Experts from the University of Edinburgh, the Roslin Institute, the Institute for Animal Health, the National CJD S...

Institute for OneWorld Health hosts panels at ASTMH

...n and practice of ORT in developing countries, and discuss novel interventions to combat secretory diarrheal disease. These experts will also share their insight on how these new strategies can be integrated into health policies that influence the current system of care. WHERE Annual Meeting of the Ameri...

A 2002 disease threat offers lessons for avian flu preparedness

As public health experts discuss how best to prevent an avian flu epidemic in the United States, La Follette School of Public Affairs assistant professor Donald P. Moynihan has a few suggestions. He outlines his ideas in a 2005 report, "Leveraging Collaborative Networks in Infrequen...

From research labs to the schools: Science teachers bring summer science to the classroom

...h APS staff, physiologists, and teacher mentors to discuss how to translate what they learned in the laboratories and in class to their own work with their students. Since the Frontiers program began in 1990, nearly 325 teachers and 211 APS members have participated. The summer grant of up to $8,500 also inc...

Understanding the oceans microbes is key to the Earth's future

...phy, invertebrate biology and virology gathered to discuss the importance of marine microorganisms to life on this planet, the biogeography of these organisms, their roles in symbiotic relationships and pathogenesis, their metabolic capabilities, their impacts on humans, and goals for research, training, and...

Teaching worms good taste: Researcher reveals the cell biology of learning at ASCB meeting

... At the ASCB meeting in San Francisco, Zhang will discuss her "worm school" experiments just published in "Nature" (10 November 2005: Vol. 438:179-184) with journalists at the "TEN AM Press Briefing" on Tuesday (Dec. 13) in Room 212 of the Moscone before her talk later in the day to the "Building Sensory Ne...

Conference to address the challenge of renewable resources

...her academics, industrialists and policy-makers to discuss the challenges the world faces in embracing renewable resources - and present novel developments in their use. The event at York will build on the success of the inaugural Renewable Resources and Biorefineries Conference hosted by the University of G...

Also in the December 21 Journal of the National Cancer Institute

... M.D., of the University of Washington in Seattle, discuss the possibility that some vaginal tumors might come from cells from cervical cancers. Feng and Kiviat suggest that the surgery used to remove the cervical cancer might harm the vaginal epithelium and make the tissue more likely to accept cancerous ce...

Genes in Uniform: Don't Test, Don't Tell

...cymakers, patient advocates, and ethicists as they discuss issues as wide ranging as genetic privacy, reproductive genetics, gene doping in sports, and safety and efficacy of commercial genetic tests....

1 2 3 4 5 6 7 8 9 10

(Date:12/1/2008)...ineered crops, sequencing the genome could be cons...e sequence is complete, the baton is passed forwar...raft sequence of the soybean genome is now availab.... Taking the next step in a new study, University ...ers have demonstrated the applicability of a genom...
(Date:12/1/2008)...ournal of the American Dietetic Association featu...ng habits of consumers. Researchers look at why fa...methods for adding healthier foods to a person,s d...Journal of the American Dietetic Association inclu... Reasons among Frequent Consumers, Menu Modeling ...
(Date:12/1/2008)...f sea and land animals around a group of Antarctic...sity and has more species than the Galapagos. The ...ow they will respond to future environmental chang...eography , the team from British Antarctic Survey ...d the land, sea and shores of the South Orkney Isl...
(Date:12/1/2008)...role in protecting us from diseases, but how does ...lden discovered that before dendritic cells move t...s helps them to move much faster. Immature dendrit... After exposure to such antigens they undergo a ri...the dendritic cells migrate to the lymph nodes to ...
Breaking Biology News(10 mins):Tool helps identify gene function in soybeans 2News from the December 2008 Journal of the American Dietetic Association 2Immune cells reveal fancy footwork 2Tolerance to inhalants may be caused by changes in gene expression 857 1Tolerance to inhalants may be caused by changes in gene expression 857 2Capps to Lead Bipartisan Womens Caucus Congressional Delegation to Represent United States at Women Deliver Conference in London 3933 1Capps to Lead Bipartisan Womens Caucus Congressional Delegation to Represent United States at Women Deliver Conference in London 3933 2Capps to Lead Bipartisan Womens Caucus Congressional Delegation to Represent United States at Women Deliver Conference in London 3933 3Jenny McCarthy Featured at National Autism Conference in Atlanta November 9 3931 1Jenny McCarthy Featured at National Autism Conference in Atlanta November 9 3931 2Greenway Medical Technologies Executive Testifies Before Congress 3929 1Greenway Medical Technologies Executive Testifies Before Congress 3929 2Greenway Medical Technologies Executive Testifies Before Congress 3929 3
Other Tagsretrieval 2eight 2eight 3eight 4eight 5eight 6eight 7eight 8eight 9eight 10surface 2surface 3surface 4surface 5surface 6surface 7surface 8surface 9surface 10
whopperstweakstelangiectasiaprimetimespectragyroscopeswooretrievaleightundiscoveredseethessurfacelaryngealanticholinergicsubwaycbs