Tag: "eighteen" at biology news

Effort to control trade in great white sharks gets teeth from international community

...rk, the largest of all fish species, growing up to eighteen meters in length (60 feet), and the second largest fish species, the basking shark. Both species are filter-feeders, and at risk from over-fishing. Reaching some six-and-a-half meters in length (21 feet), the great white shark is a member of the mac...

BioMed Central announces publishing partnership with The Scientist magazine

...rint and online subscriptions, providing access to eighteen years of outstanding content, with the added benefits of online usage statistics, customer support and 24/7 service reliability. Richard Gallagher, Editor and Publisher of The Scientist explains, " We decided to partner with BioMed Central because t...

DFG to fund 14 new research training groups

...ugh the excellence initiative, which was announced eighteen months ago, and is still a matter of controversial debate between federal and individual state governments, is still planned. The DFG is currently funding a total of 269 Research Training Groups, 38 of which are International Research Training Groups...

Secret of smallpox's success may lead to bioterror cure

...s projected to yield a usable vaccine virus within eighteen months. At that point, the virus will go to a commercial manufacturer, who will be responsible for developing and then producing a complete nasal-delivery vaccine. If all is successful, a large number of doses will then be produced and put into stora...

Dramatic rise in number of authors publishing in open access journals, independent survey finds

... according to a new independent survey. This is up eighteen percentage points compared to a similar question asked in a study carried out in 2004 by the same researchers, a two-and-a-half-fold increase in just twelve months. BioMed Central is delighted that independent research is now available that confirms ...

Researchers alleviate symptoms of Rett syndrome in mice

...irls with Rett develop normally until about six to eighteen months, when things begin to go terribly wrong. Their health deteriorates, and they begin to show symptoms such as loss of speech, loss of voluntary motor control, constant hand wringing and seizures. In March 2001, researchers in the Jaenisch lab p...

Tips from the journals of the American Society for Microbiology

...a novel genotype (GII.4) as the infective agent in eighteen outbreaks being investigated. Since its discovery, this new variant now referred to as Hunter virus, has been associated with large epidemics of gastroenteritis in The Netherlands, Japan and Taiwan. "While the origin of the Hunter strain is unknown,...

16 outstanding researchers receive Singapore's highest honor in science and technology

...sults from Dr Yu's research have been published in eighteen articles in international refereed journals, such as Nature, Nature Genetics, Plant Cell, PNAS, and Plant Journal. He was the recipient of Gold medal of International Society of Plant Molecular Biology (ISPMB) for outstanding NUS Ph.D thesis in 2001....

Epigenetic drugs, promising for breast cancer treatment

...une recognition of tumour cells, such as p53, p21, eighteen members of the oxidative phosphorylation pathway, interferon-regulatory factors, NM23, negative regulators of Wnt signalling and Major Histocompatibility Complex Class-I and II genes. In addition, these drugs down-regulate genes such as ABCB5, a rece...

Study provides first genetic evidence of long-lived African presence within Britain

... Britain, the team recruited and studied a further eighteen males with the same surname as Mr. X. All but one were from the UK, with paternal parents and grandparents also born in Britain. Six, including one male in the US whose ancestors had migrated from England in 1894, were found to have the hgA1 chromoso...

Enzyme Engineering XIX

...ngineering throughout the world. Like the previous eighteen conferences spanning the last 38 years, this one will be a scientifically challenging and highly stimulating blend of academia and industry that should once again resonate strongly with those within the applied biotechnology fields. Topics for the ...

National Academy of Sciences elects 2 Brandeis University scientists to membership

...S. scientist or engineer. Today 72 new members and eighteen foreign associates were elected to the Academy, bringing the total to 2,025 members. With the election of Marder and Miller to the Academy, Brandeis counts ten NAS members, a remarkable achievement for a small research university. In addition, two Br...

Inflammation may cause preterm labor and fetal deaths

... block the receptors inflammatory response. Within eighteen hours, inflammation was present in the TLR4 mice. The researchers wrote, F. nucleatum colonization in the mouse placenta was accompanied by inflammation, similar to intrauterine infection in humans, suggesting placental inflammatory response as an...

1

(Date:4/17/2014)... recent Yokahama IPCC meeting painted a stark warning on ... which has a greenhouse effect 32 times that of ... shown that humic substances act as fully regenerable electron ... are held in wetlands instead of being released to ... system is disrupted it may enter into a vicious ...
(Date:4/17/2014)... the genetic information of DNA is used to ... numerous different functions in living organisms. Messenger RNA ... expression, by relating the genetic information of DNA ... , By examining the different types and ... at a given time, researchers can determine which ...
(Date:4/17/2014)... way the immune system may fight cancers and viral ... cells to treat illness. , The research, in mice, ... "neighborhood police" specialized squads of defenders that patrol ... entire city, the body. , Scientists at Washington University ... the liver, skin and uterus each has dedicated immune ...
Breaking Biology News(10 mins):Methane climate change risk suggested by proof of redox cycling of humic substances 2Rapid and accurate mRNA detection in plant tissues 2Some immune cells defend only 1 organ 2
Other Tags
pandoraswettergrasslandsleftieshygieniccapacitiesmusculaturemirnasawaresummitkyotoesabrachytherapyinversetemporarilysue