Tag: "elevated" at biology news

Study separates behavioral and physiological mechanisms in testosterone mediated trade-offs

...iness of a potential mate. The mechanisms linking elevated testosterone and increased parasite infection remains little know in wild animals. One possibility is that testosterone modifies behavior and increases exposure to infective parasite larvae. An alternative mechanism is related to the physiological ac...

Immune system's distress signal tells bacteria when to strike back

...ammatory bowel disease patients, for example, have elevated cytokines the chemical messengers that trigger an immune response in the bowel. "These could signal the bug," said Alverdy, "then the bug strikes back and then the inflammation process snowballs." Because the bacteria in this case are "normal flo...

JCI Table of contents August 1, 2005

...tion and excretion of bile acids were dramatically elevated in beta Klotho-null mice. The expression of two key bile acid synthesis genes, the nuclear receptors regulating these genes, and the liver circulation was intact. However, the negative feedback suppression of one bile acid synthesis gene was signifi...

UT Southwestern researchers find differences in a predictor of heart disease among sexes, races

...vents, as more than one-half of these patients had elevated levels. But there are currently few studies of CRP in black patients. Dr. James de Lemos, assistant professor of internal medicine and the study's senior author, said: "This is a large study that highlights potentially important race and gender diffe...

Penn State to host US DOE regional climate center

...ing the effects of warming, altered precipitation, elevated carbon dioxide concentration, elevated ozone on terrestrial ecosystems, developing and evaluating models to predict the effects of climate ...

OHSU researchers discover potential mechanism to repair brain damage linked to MS

...ever, instead of developing tumors, the mice with elevated CD44 developed tremors similar to those seen in in... from repairing the damaged myelin when there were elevated levels of HA," explained Bebo. "By studying another mouse model in my lab, we made the connection be...

Field tested: Grasslands won't help buffer climate change as carbon dioxide levels rise

...trongest effects on grassland production came from elevated levels of nitrogen (which typically reaches a fertilization limit). Elevated temperature, rainfall, and, surprisingly, CO 2 , had minimal impacts. These results suggest that increasing concentrations of atmospheric CO 2 are not likely to increase gr...

Rethinking anti-oxidants

...ple who suffer from atherosclerosis, or who are at elevated risk of heart disease, gain benefit by supplements of vitamin E," said Professor Roland Stocker, from the Centre for Vascular Research at UNSW, who will present his research at the ISTH Congress in Sydney today. Stocker reported, "Our research is n...

Study yields mixed results on potential for pine trees to store extra carbon dioxide

...ol trees. Their analysis revealed that pines under elevated CO2 levels experienced 25 percent extra growth in ...seasonal precipitation patterns." After those most elevated years, enhanced growth in the CO2 began dropping unevenly in a zigzag fashion. In 2000 it was 19 per...

High carbon dioxide levels spur Southern pines to grow more needles

...are left as untreated controls for comparison. The elevated carbon dioxide is delivered from rings of towers i... years of the FACE experiment, the pines receiving elevated CO2 had on average about 17 percent more needles than untreated pines. Higher needle percentages in ...

Research may lead to optimization of radiation treatment

...ducible factor-1 (HIF-1) levels in tumors and that elevated HIF-1 can promote the resistance of tumors to radiation because it has a protective effect on tumor blood vessels. Although this work suggested that inhibition of HIF-1 would make tumors more sensitive to radiation treatment, HIF-1 can also influenc...

Leptin-signaling protein maintains normal body weight and energy balance in mice

...mates, consume nearly two times as much food, have elevated fatty acid and triglyceride levels, are resistant to insulin, and often develop type 2 diabetes. Scientists at the University of Michigan Medical School are studying these mice to find out what causes their over-eating and morbid obesity. Is it a cha...

Life-extending protein keeps blood sugar in check

...ions, when glucose levels are lower, the mice with elevated Sirt1 appear normal," Imai added. "This is good news, suggesting that therapies designed to manipulate the amount of Sirt1 might improve insulin response in those with type 2 diabetes without causing other problems." Pancreatic b cells have a highly ...

Weight control protein may yield antiobesity drugs

...Rui said. Moreover, the animals developed severely elevated blood sugar, insulin, and leptin concentrations. Elevated leptin levels are a hallmark of leptin resistance, a primary risk factor for obesity, he added. Further examination found that the animals lacking SH2-B ate nearly twice as much as normal. Sur...

Other highlights in the August 17 JNCI

...aving one or more extra X chromosomes--may have an elevated risk of non-Hodgkin lymphoma and breast and lung cancers. Men with Klinefelter syndrome may have hypogonadism or other hormonal, physical, or developmental abnormalities. Case reports have suggested that these men may have an increased risk of severa...

Researchers discover new route to hemoglobin synthesis

...of anemia, known as sideroblastic anemia, in which elevated IRP1 activity causes a deficiency of ALAS2. In most cases, an increase in IRP1 is likely caused by a mutation in a transporter for iron-sulfur clusters that traps them in mitochondria, where they cannot interact with IRP1 to control it. In a search f...

Climate model links higher temperatures to prehistoric extinction

... atmosphere. "The implication of our study is that elevated CO2 is sufficient to lead to inhospitable conditions for marine life and excessively high temperatures over land would contribute to the demise of terrestrial life," the authors concluded in the article. The CCSM's simulations showed that ocean circu...

JCI table of contents September 1, 2005

...l death-enhancing toxin. Levels of this toxin were elevated in AD transgenic mice and in brains from AD patients, but not from brains of patients with other neurological diseases. This chemical reaction may explain why high cholesterol is a risk factor for AD, and may explain why copper-binding drugs and sta...

A new player in the battle against hepatitis prevents inflammation and the death of liver cells

... double protection to liver cells in mice. With an elevated production of ABIN-1, this protein will neutralize... responsible for inflammations, is inhibited by an elevated presence of ABIN-1. In addition, ABIN-1 also counteracts the death of liver cells. Further research ...

Chernobyl: The true scale of the accident

...nd animal feed into milk, was an early concern and elevated levels were seen in some parts of the former Sovie...bioaccumulation in the aquatic food chain, though, elevated concentrations of radiocaesium were found in fish from lakes as far away as Germany and Scandinavia....

1 2 3 4 5 6 7 8 9 10

(Date:4/17/2014)... hundred births, Down syndrome - or trisomy 21 - ... It results from a chromosomal abnormality where cells of ... (1% of the human genome). A study conducted by ... Genetic Medicine and Development at the University of Geneva ... shed light on how the extra chromosome 21 upsets ...
(Date:4/17/2014)... Clemson professor Rajendra Singh Thursday as a "Champion ... expand solar deployment in the residential, commercial and ... Professor of Electrical and Computer Engineering and director ... a local hero leading the charge across the ... solar power and driving policy changes at the ...
(Date:4/17/2014)... such as heart disease, epilepsy and pain, making them ... is still much scientists do not know about the ... into the structure of sodium channels and, specifically, one ... responsible for ,fine-tuning, the activity of the channel. The ... the Journal of Biological Chemistry . , Nerves ...
Breaking Biology News(10 mins):Trisomy 21: How an extra little chromosome throws the entire genome off balance 2Trisomy 21: How an extra little chromosome throws the entire genome off balance 3White House honors Clemson professor as 'Champion of Change' for solar deployment 2Structure of sodium channels different than previously believed 2
Other Tags
architectsbeaverrunawaycaspaseclindamycinplentifulpertussisimmunogenicityallergenillnessessupplementsherbalprofessorshipbassetspaceddocument