Tag: "endowed" at biology news

American Chemical Society's Weekly PressPac -- July 18, 2007

...The oil droplet shown in this short video has been endowed by scientists with the ability to undergo sustained, forward movement, a development that could one day provide the basis for giving artificial cells the ability to move. To view video, CLICK HERE (Courtesy of Tadashi Sugawara, University of Tokyo.) ...

Washington University in St. Louis to invest $55 million for renewable energy research

...ctices. Washington University is creating five new endowed professorships in the fields of energy, environmen... Wilson Hall on the Danforth Campus. Fund five new endowed professorships in science, engineering, architecture, social science or medicine to attract research...

Revelle family endows UC San Diego chair honoring Roger Revelle

...sents the largest single donation ever made for an endowed chair in the 104-year history of Scripps Oceanography. Funds for the endowed chair will be used to recruit an outstanding climate scientist for Scripps, one of the worlds foremo...

Bioluminescence at the service of a novel cerebral imaging technique

...ity, because it has recently been shown that flies endowed with a mutation of the insulin receptor live much longer. It is also possible to exploit the powerful genetic tools of the Drosphila to study and compare these maps in flies bearing different mutations, or in flies which serve as models for a variet...

Physicist S. James Gates, Jr. receives AAAS award

...d, he became the first African American to hold an endowed chair in physics at a major research university in the United States. He received his B.S. degree in mathematics and physics from the Massachusetts Institute of Technology in 1973 and his Ph.D. degree in elementary particle physics and quantum field ...

Shedding new light on proteorhodopsin

.... However, in experiments in which marine bacteria endowed with proteorhodopsin were exposed to light, there was no response. This begged the question: What does proteorhodopsin actually do? A recent study out of the University of Kalmar in Sweden, led by Jarone Pinhassi, showed that light could be used t...

Decision-making -- Demonstration of a link between cognition and execution

...s to the target (motor information). The brain is endowed with one or several structures which can integrate both cognitive information (enabling a reasoned choice which is not based on chance) and motor information. It is supposed that the basal ganglia play an essential role in these processes. However,...

Nicotine: The link between cigarette smoking and kidney disease progression?

...C) cells in the blood vessels of the kidneys are endowed with nicotinic receptors (nAChRs) 4, 5, 7, 2, 3, 4 and 5 (cells that interact with the nicotine in tobacco) and may play an active role in the development of certain kidney diseases. The Study The study, "Nicotine: The Link Between Cigarette Sm...

Leibniz Prize winners 2007 announced

...d two women as recipients of Germanys most highly endowed research award. For the first time, the prize winners for 2007 will receive up to 2.5 million euros (previously: 1.55 million euros) and be able to use these funds flexibly over a period of seven years (previously: five years) to finance their resear...

Ludwig Fund donates $20 million to University of Chicago for cancer research

...ion. The Ludwig Fund has expended $50 million for endowed chairs at the six beneficiary institutions. Ludwig died in 1992. According to Lloyd J. Old, M.D., Chairman of the Ludwig Fund's Trustees, Ludwig considered cancer to be one of humanity's great challenges. His business model was "to engage great mi...

Decisions on the first round of the excellence initiative announced

... funding line "institutional strategies" was to be endowed with about 21 million euros per year, including the resources for the first two funding lines. However, these amounts are only guidelines, as today's differentiated decisions demonstrate. Second round of proposals: The second round of proposals f...

Study provides insight into how the brain loses plasticity of youth

...mice also exhibited greater plasticity than brains endowed with the protein. Taken together, the results have important implications for the future study and repair of the brain. "Our study of mutant mice lacking PirB function reveals that at all ages, even during critical periods when circuits are prone to ...

JCI table of contents: June 22, 2006

...cted an avirulent strain of Salmonella typhimurium endowed with the capacity to deliver the known tumor cell antigen NY-ESO-1. This approach was able to elicit NY-ESO-1specific CD8+ and CD4+ T cells from lymphocytes taken from cancer patients. Oral delivery of this vaccine to mice resulted in the regression ...

From vomiting to vaccination: Food poisoning bug used to deliver cancer vaccine

...cted an avirulent strain of Salmonella typhimurium endowed with the capacity to deliver the known tumor cell antigen NY-ESO-1. This approach was able to elicit NY-ESO-1specific CD8+ and CD4+ T cells from lymphocytes taken from cancer patients. Oral delivery of this vaccine to mice resulted in the regression ...

Immunology symposium to honor Dr. Robert Good's legacy

...outh Florida and All Children's Hospital, where an endowed chair in pediatric immunology was created in his name. More than 300 physicians and scientists he trained or mentored during his career hold leadership positions at such esteemed institutions as Harvard Medical School, the National Institutes of Heal...

ACS news service weekly press package - May 15, 2006

...on of cells, including BrCSCs in breast cancer, is endowed with that ability. Research has been hampered, however, because BrCSCs are scarce in tumors. Scientists have been unable to obtain enough BrCSCs for many analytical studies. Leo A. Behie and colleagues from Canada are reporting the development of bio...

Dan David Prize awarded to two leading American cancer researchers

... Aviv University. A joint international enterprise endowed by the Dan David Foundation and headquartered at Tel Aviv University, the prize recognizes and encourages innovative and interdisciplinary research that cuts across traditional boundaries and paradigms. It aims to foster universal values of excellenc...

Learning the lessons of the world's oldest ecological experiment

...y change under different selection pressures and endowed us with an archive of soil and hay samples that have been used to track the history of atmospheric pollution, including nuclear fallout. "Today, Park Grass has acquired new relevance for the study of fundamental ecological processes and for nature ...

High resolution 'snapshots' detail dynamics of a cocaine antibody

... treat cocaine abuse." Using a monoclonal antibody endowed not only with high binding ability, but also with sufficient catalytic activity to metabolize cocaine, would have potentially enhanced therapeutic effects, Zhu said. This antibody could intercept cocaine in the blood stream before it reaches the cent...

Progress needed on global regime for access to genetic resources and benefit-sharing

... instrument for fighting poverty in poor countries endowed with tremendous biological resources. It is for this reason that it can contribute to the achievement of lasting peace and security as well as to the realization of shared prosperity for all the World." The current uncertainty surrounding the issue o...

1 2

(Date:5/16/2013)... -- Injectable nanoparticles developed at MIT may someday ... diabetes to constantly monitor their blood-sugar levels and ... designed to sense glucose levels in the body ... insulin, thereby replacing the function of pancreatic islet ... 1 diabetes. Ultimately, this type of system could ...
(Date:5/16/2013)... relationship between the heritable risk for schizophrenia and ... is commonly associated with cognitive impairments that may ... IQ may be linked to the risk for ... precede the onset of schizophrenia symptoms. Also, these ... people diagnosed with schizophrenia. , In a remarkable ...
(Date:5/16/2013)... May 16, 2013 Integrated Biometrics patented ... a custom thin film transistor camera introduces Sherlock, ... roll image in the smallest and lightest form ... Appendix F Mobile ID FAP 45, Certified scanner ... in size and weight when compared to optical ...
Breaking Biology News(10 mins):Nanotechnology could help fight diabetes 2Nanotechnology could help fight diabetes 3Genetic risk for schizophrenia is connected to reduced IQ 2
Other Tags
sarawakmalaysianweevilnicetrendupwardpredisposingemphasiscouricmovieadvisestraymitigatesolicitousnessgastroenteritisgatorade