Tag: "entering" at biology news

Viruses found in untreated city water

...les specific to each well and prevent viruses from entering the drinking water supply. "We know from our previous studies on groundwater flow in La Crosse that some city wells have high levels of Mississippi River infiltration, other wells have intermediate levels and the remaining wells have little river wat...

Old bones unearth new date for giant deer's last stand

...t that the antlers would have prevented males from entering even moderately dense woods, at least for part of the year, and one former theory for their extinction was that the seasonal nutrient requirements for the antlers alone might have killed off the species. Traditionally, woolly mammoths were believed t...

Protein protecting brain from toxins also blocks some chemotherapy from reaching tumors

...semble topotecan, from leaving the bloodstream and entering the brain. The cells lining the walls of brain cap...ertain substances from leaving the bloodstream and entering the brain. Mrp4 in the blood-brain barrier also prevents substances from entering the brain by trans...

Bloodroot alkaloid aids in exterminating sun-damaged skin cells in culture

...nd a 49-66 percent increase in the number of cells entering apoptosis. By pre-treating the cells with a low concentration (50 nM) of sanguinarine, Ahmad and his associates observed that the natural plant-based anti-oxidant agent induced a 54-72 percent decrease in cell viability after UVB. The rate of apoptos...

Academics find that the finger of destiny points their way

...minated the past and this may be putting women off entering it, even though they are able to. "Why male scientists should have fewer children is not known. "The study of my colleagues at the University of Bath was also interesting in that it shows that women in social science tend to have a higher level of te...

Brain differences in adolescents, psychopaths, lend to their impulsive, risk-taking behavior

...o explore and its fear of open spaces. An animal's entering the exposed areas of the maze indicates lower anxi...the rat's head into the open area without actually entering it (stretched attenuated posture) indicates assessment of risk. The researchers found that...

Research confirms that vCJD prions can be removed from blood

...e spongiform encephalopathy (BSE) in cattle before entering the food supply. The new filter is an integral component of the Pall Life Sciences technology platform, which provides several products to enhance the safety of the world's blood supply. Pall is the global leader in leukocyte reduction technology a...

Story tips from the Department of Energy's Oak Ridge National Laboratory

...ed about one-fourth of the nitrogen and phosphorus entering the stream from the watershed. The immediate benefit is reduced concentrations of these nutrients reaching downstream lakes, estuaries and the ocean. Removal of nitrogen and phosphorus from stream water was highly seasonal and responsive to forest pr...

Molecular technique shows promise in destroying drug resistance in bacteria

... antibiotics out of the cell, preventing them from entering the cell or demolishing them. A common way bacteria develop resistance is by laterally transferring plasmids -- pieces of extra-chromosomal DNA -- from one bacterium to another. These plasmids contain genetic codes for proteins that make bacteria i...

Investigating the Columbia River and Estuary: A primary focus of research

...stage fall Chinook salmon from hexavalent chromium entering the Columbia River from Hanford groundwater. The study addresses survival, differences in development and growth from eyed-egg stage to swim-up stage. The presentations will be conducted in Rooms B113 and B114, Portland Convention Center between 8...

Diamonds are a urologist's best friend

...been any effective way of preventing bacteria from entering the urinary tract via the catheter and thereby triggering urinary tract infection,' the Bonn researcher Dr. Norbert Laube explains. Several species of bacteria cause a steep increase in the urine pH value by their metabolism. The result is that salts...

'Blind' cells see the light; maybe someday humans will, too

...hose axons bundle together to form the optic nerve entering the brain, allow the patient to see little more than patches of light and dark, Kramer noted. Kramer, a researcher with UC Berkeley's Helen Wills Neuroscience Research Institute and a member of the campus's Health Sciences Initiative, studies ion cha...

Northwestern and Chicago Botanic Garden join forces to train botanists

...plications are being accepted for the first class, entering in fall 2005. The master's degree -- five core courses, four electives, independent research and a thesis -- can be finished in four or five quarters. Molecular biology, biostatistics and plant science will be at the curriculum's core; the independen...

UT Southwestern researchers trace how virus that causes AIDS spreads following oral exposure

...he stomach acids probably prevented the virus from entering through the stomach or intestines. "It is clear from our study that the oral and esophageal mucosa and the tonsils are likely to be the most important sites of viral entry," Dr. Sodora said. "These tissues should be a major focus of any additional st...

Scientists discover key egg enzyme for blocking sperm entry after fertilization

...s an egg to physically block additional sperm from entering after fertilization. Preventing polyspermy in sea urchins and many other animals involves a dramatic transformation including a respiratory burst characterized by massive production of hydrogen peroxide near the surface of the egg. Although this ph...

Nanotubes glow, even within biological cells

...he nanotubes retain their optical signatures after entering the white blood cells, but the introduction of nanotubes caused no measurable change in cell properties like shape, rate of growth or the ability to adhere to surfaces. In conducting the tests, Weisman was joined by colleagues Paul Cherukuri a...

Exploring ocean life and color on the internet

...r said. "At first it looked like a small river was entering the Red Sea. But there aren't any rivers in this part of the desert." Further investigation indicated that this area was associated with a large coral reef complex on the Red Sea coast. A third tutorial examines the California coast near Monterey Bay...

Poison digs its own grave

...as partly controlled by the toxic substances. Upon entering the fungus, these stimulate the fungal DNA to produce certain proteins, which then immediately pump these substances out of the fungus. The researcher established that this mechanism in B. cinerea is comparable to multiple drug resistance in humans....

ESA's Huygens begins its final journey into the unknown

...here at about 09:06 UTC (10:06 CET) on 14 January, entering at a relatively steep angle of 65 and a velocity of about 6 km/s. The target is over the southern hemisphere, on the day side. Protected by an ablative thermal shield, the probe will decelerate to 400 m/s within 3 minutes before it deploys a 2.6 m pi...

Weill Cornell team develops fast-acting anthrax vaccine

...of the anthrax toxin." Genes need a live means of entering the body, however, so Dr. Crystal's team incorporated the gene within a harmless organism called an adenovirus. "The adenovirus delivers the gene to the mouse, and then the gene goes to work -- telling the animal's body to make this antibody against...

1 2 3 4 5 6 7 8 9 10

(Date:10/31/2014)... good for attracting species, but it may not be enough ... study has found. , The researchers surveyed two types of ... abundance of two insects that interact with them. They found ... and black walnut, they didn,t find a corresponding abundance of ... the walnuts and black cherries and a type of wasp ...
(Date:10/31/2014)... 30, 2014  HITLAB SM , a healthcare ... its inaugural HITLAB Innovators Summit SM on ... HITLAB will partner with the Clinton Foundation,s Health ... ProtoHack, Columbia Business School Alumni Club of ... Engineering and Operations Research, bringing together leaders in ...
(Date:10/30/2014)... 2014—Oligonucleotide-based therapeutics present unique challenges when it comes ... developmental harm. New consensus guidelines for toxicity testing ... biological characteristics of these novel biopharmaceuticals are presented ... journal from Mary Ann Liebert, Inc. publishers ... Nucleic Acid Therapeutics website until November ...
Breaking Biology News(10 mins):Green spaces don't ensure biodiversity in urban areas 2HITLAB Announces Inaugural HITLAB Innovators Summit 2HITLAB Announces Inaugural HITLAB Innovators Summit 3New guidelines for reproductive & developmental toxicity testing of oligonucleotide drugs 2
Other Tags
despiteeasyfrogsdeformedarrivestartpartyamokcorporateresponsibilitywalkspercentageaffectingfundsaimssporting