Tag: "entomologists" at biology news

How to use math and a CT scanner to see how trees intercept light

...ences. As an example, he is currently working with entomologists (insect researchers) to assess the impact of a variety of transgenic cotton on butterfly populations. The CT scanning facility that he co-ordinated the creation and start-up of provide researchers in plant, soil and animal sciences with an amazing t...

Multi-species herbivore outbreak follows El Nio drought in Panama

... Wondering if this was a country-wide phenomenon, entomologists at STRI's research station on Barro Colorado Island and at the Sherman Canopy Crane near Panama's Atlantic coast were advised to be on the lookout for increases in butterfly and moth larvae populations. However, lepidopteran numbers remained stable t...

UCSD discovery may help extend life of natural pesticide

...ichael Adang and Stephan Garczynski, coauthors and entomologists at the University of Georgia, showed that the glycolipid receptor is present in the tobacco hornworm, an insect pest that is susceptible to Bt toxins used commercially in plants. "It will now be possible to monitor insect populations near fields wher...

Slime-mold beetles named for Bush, Cheney, Rumsfeld

... named in his honor. Two former Cornell University entomologists who recently had the job of naming 65 new species ...Wheeler and A. rumsfeldi Miller and Wheeler. The entomologists also named some of the new species after their wives and a former wife, Pocahontas, Hernan Cortez, t...

Researchers determine temperature-driven rootworm forecast

.... But two Texas Agricultural Experiment Station entomologists think theycan reduce these losses with a new model to predict and better target thepests. The model developed by Dr. Jerry Michels, Experiment Stationentomologist in Bushland, and Dr. Marvin Harris, Experiment Stationentomologist in College Statio...

Humans trading short-term food production for long-term environmental losses

...d-use planners, climatologists and architects, and entomologists (insect scientists) and physicians and the development of land-use strategies that recognize both short- and long-term needs. Such collaboration and long-range planning is at the heart of UAF's RAP. "We need manager and policy makers who understand ...

Rutgers entomologist honored by Chinese Academy of Sciences

...In the past, he has obtained Lindbergh funding for entomologists in Ethiopia, organized a workshop in Israel and led a symposium in Egypt. In addition, he has served on dissertation committees in Cuba, Egypt, India and Thailand. In nominating Gaugler for the ESA Fellowship, Karl Maramorosch, Robert L. Starkey Prof...

Surprising genetic differences id-ed in southern house mosquito

... of Natural Sciences. This research helps medical entomologists and doctors understand why certain infectious diseases occur in parts of the world but not in others depending on the presence of the disease-transmitting mosquito strains. In a paper published in the February issue of the American Journal of Tropic...

Sociality of sweat bees evolved simultaneously during climate change

...al evolution to climate change, Cornell University entomologists show that the social behavior of many species of sweat bees evolved simultaneously during a period of global warming. This social evolution occurred much more recently than scientists ever thought -- only 20 million to 22 million years ago, compared...

Liquid Jungle Lab environs -- home to five new species

...mphidraus sp. nov), collected and characterized by entomologists at the University of Panama. Bahia Honda forms part of the buffer zone of Panama's newly established Coiba National Park and UNESCO World Heritage site. This hefty volume will be essential gear for the shapers of a new Management Plan for Coiba and...

Rearing an army to save wheat

...atural enemies in demand, Montana State University entomologists are investigating ways of increasing their availability. This fall, the entomologists are concluding a two-year study that involved mass-rearing parasitic wasps that attack wheat stem sa...

UCR researchers win Entomological Society of America Awards

RIVERSIDE, Calif. -- Two UC Riverside entomologists have won awards from the Entomological Society of America (ESA), the ESA has announced. Michael E. Adams, a professor of entomology and neuroscience, won the Recognition Award in Insect Physiology, Biochemistry, & Toxicology. Jeremy D. Allison, a gr...

Smithsonian scientists show differing patterns of rainforest biodiversity

...e worlds biodiversity. An international group of entomologists and botanists, including Smithsonian researchers, has assembled data representing 500 species of caterpillars, ambrosia beetles and fruit flies in the undisturbed lowland rainforest of the Sepik and Ramu river basins in Papua New Guinea. The team col...

Multinational research: protecting ecology means understanding people, too

...rest service will lose more than 80 percent of its entomologists and 49 percent of its foresters, and the EPA will lose 45 percent of its toxicologists and 30 percent of its environmental specialists. Its good timing for students as well, they say. Students are hungry for this kind of program, Stronza said. Th...

1

(Date:7/25/2014)... molecular testing panel developed at UPMC greatly increases ... for patients with thyroid nodules and cancer, report ... (UPCI), partner with UPMC CancerCenter., The test, available ... diagnostic testing agencies, improved the chances of patients ... according to the study published this month in ...
(Date:7/24/2014)... Scientists at The New York Stem Cell ... to creating a viable cell replacement therapy for ... , For the first time, NYSCF scientists generated ... samples of patients with primary progressive multiple sclerosis ... induce these stem cells into becoming oligodendrocytes, the ...
(Date:7/24/2014)... , July 24, 2014 /PRNewswire-iReach/ -- The Geneva ... from cardiac devices, has cut emergency room wait times ... San Diego (UCSD) Medical Center, according to a recent ... UCSD Emergency Departments are using the suite to access ... pacemakers or defibrillators. "Using Geneva,s technology platform ...
Breaking Biology News(10 mins):Test increases odds of correct surgery for thyroid cancer patients 2Test increases odds of correct surgery for thyroid cancer patients 3NYSCF scientists one step closer to cell therapy for multiple sclerosis patients 2UC San Diego Medical Center Cuts Average ER Wait Time by 92 Minutes using the Geneva Healthcare Suite 2UC San Diego Medical Center Cuts Average ER Wait Time by 92 Minutes using the Geneva Healthcare Suite 3
Other Tags
historyevolutionarysalamanderrewritesbrewsphysicistsmillipedescavechemoembolisationpfilegatomariannepersonalizedheaviertvsenlargement