Tag: "escaping" at biology news

Rutgers: GM/GMO/Biotech crop containment strategy

...d abroad, coming from concerns about foreign genes escaping from GM crops, crossing with and contaminating other crops and wild species, and disrupting the ecosystem. Pursuing the approach elucidated and advocated by the Rutgers researchers findings may allay some of these fears and deflate the more vocifer...

Magnetic field uses sound waves to ignite sun's ring of fire

Sound waves escaping the sun's interior create fountains of hot gas that shape and power a thin region of the sun's atmosphere which appears as a ruby red "ring of fire" around the moon during a total solar eclipse, according to research funded by the National Science Fo...

Cooperative science program yields results

...minary look at the cod size data, the cod that are escaping are mostly smaller fish that are less valuable in the market and best returned to the sea." Gauvin noted that these results are considered preliminary and more analysis of the data will occur over the coming weeks to identify important factors affe...

Farmed salmon could become an invasive species in forest streams

... become the next invasive species. "Farmed fish escaping from marine net pens might become an invasive species in British Columbia, Washington or Alaska," says research fish biologist Peter Bisson. "Net pen culture of salmon is big business worldwide, and both advocates and opponents of salmon farming have...

Intensified research effort yields climate-resilient agriculture to blunt impact of global warming

...d have the added benefit of preventing carbon from escaping from the soil into the atmosphere. Managing greenhouse gases The CGIAR-supported centers are working with farmers to develop and test innovative practices capable of contributing to the net reduction of atmospheric carbon on three fronts: stanc...

ACS News Service Weekly PressPac -- Nov. 15, 2006

...ck into space and preventing terrestrial heat from escaping into space. In addition, ice particles in SVCs have a drying or dehydrating effect on the upper troposphere. "Here we show, to our best knowledge for the first time, that the small ice particles are not completely solid, as is usually believed, but r...

JCI table of contents: September 1, 2006

...duals is able to prevent T. gondii from hiding and escaping destruction. Macrophages are an important immune cell type that can take up pathogens and destroy them. However, some pathogens, including T. gondii, are able to survive inside macrophages because they hide from the destruction machinery of the cel...

Predators prefer to hunt small-brained prey

...exceptionally large brains and are more capable of escaping attacks. The study, carried out by Dr Susanne Shultz, from the School of Biological Sciences, focused on predators from Africa and South America such as the jaguar, chimpanzee, leopard and puma. Dr Shultz found that prey with a small brain such as ...

Speeding discovery of the 'human cancer genome'

...at requires and selects for tumor cells capable of escaping their normal microenvironment, traversing into and out of lymphatic or blood vessels, and proliferating in new "soil," the researchers said. Metastasis is particularly important in skin cancer, Chin added, as the primary tumor is almost always cura...

ACS News Service weekly press package -- June 5, 2006

... way to make round salt Reduced risk of plutonium escaping from nuclear waste sites Branching out to a new d...smcri.org ARTICLE #3 Reduced risk of plutonium escaping from nuclear waste sites Environmental Science & Technology If plutonium escapes from underground r...

A tumour suppressor in mice and men

... well regulated processes. Even just a single cell escaping this regulation can lead to a tumour. Oncogenes are, in this sense, like ticking time bombs, which can cause cancer. Their activity is controlled in healthy cells by tumour suppressor genes. The cellular "opponents" of the Bcl-3 oncogene, however, ha...

The secret lives of sea slugs

...ating beneficial navigational behaviors, including escaping from predators by swimming up into water currents that hurl them (un-sluggishly) end over end downstream and away from harm, as well as crawling aggressively (for slugs) upstream to breed and feed. The observations also correlated with earlier studie...

UCSD study reveals how plants respond to elevated carbon dioxide

...Schroeder. "On the other hand, less water would be escaping through the pores, so the response might help plants use water more efficiently. Each plant species shows a different carbon dioxide responsiveness, and understanding the underlying mechanisms may make it possible to engineer improved water use effic...

Protowings may have helped bird ancestors cover rough terrain

...mably have had an advantage when pursuing prey and escaping from predators. Dial and colleagues performed experiments on several species of juvenile galliform (chicken-like) birds, concentrating on chukar partridges. Chukars can run 12 hours after hatching, but they cannot fly until they are about a week old...

Plants used to detect gas leaks, from outer space!

... stressed. In the area surrounding a gas leak the escaping methane means the plant roots cannot get enough oxygen and so aerial parts of the plant appear stressed in satellite images detecting reflected light. This remote-sensing technology can be used to detect any type of stress that causes asphyxiation o...

Genomics-based vaccine could prevent deadly cattle disease

...t Coast fever destroys the small farmer's dream of escaping poverty in Africa. Killing more than a million cattle and costing some $200 million annually, this tick-borne disease rages across a dozen countries in eastern and central Africa. Now, an international team of scientists has taken the first major ste...

Polymer gel can block toxic leakage problem in gene therapy

...routes for the viral escapes. Those particles were escaping from the tumor area into the bloodstream through rifts in tiny tumor blood vessels created by damage from the injection needle. Yuan said such viral escapes are inevitable since the needle's diameter is 30 times larger than the width of the microvess...

Ranks of 'environmental refugees' swell, calls grow for better definition, recognition, support

...ill need to cope with as many as 50 million people escaping the effects of creeping environmental deterioration, United Nations University experts say the international community urgently needs to define, recognize and extend support to this new category of 'refugee'. In a statement to mark the International ...

It's a bug's life: MIT team tells moving tale

...r? "There are many reasons, such as laying eggs or escaping predators," said Hu. Menisci are all around us -- picture the slight upward curve of water in a glass where it meets the side. "But we don't notice them because they're so small, only a few millimeters in height," said Hu. But if you're a creature th...

Breast tumors in mice eradicated using cancer vaccine

...the induction of helper T cells, others survive by escaping into the cytosol of the cell. This is important because the antigen-processing pathway that feeds antigenic peptides to the surface of the cell for recognition by killer T cells is generated in this cellular compartment. "We reasoned that if we could...

1 2

(Date:4/17/2014)... hundred births, Down syndrome - or trisomy 21 - ... It results from a chromosomal abnormality where cells of ... (1% of the human genome). A study conducted by ... Genetic Medicine and Development at the University of Geneva ... shed light on how the extra chromosome 21 upsets ...
(Date:4/17/2014)... Clemson professor Rajendra Singh Thursday as a "Champion ... expand solar deployment in the residential, commercial and ... Professor of Electrical and Computer Engineering and director ... a local hero leading the charge across the ... solar power and driving policy changes at the ...
(Date:4/17/2014)... such as heart disease, epilepsy and pain, making them ... is still much scientists do not know about the ... into the structure of sodium channels and, specifically, one ... responsible for ,fine-tuning, the activity of the channel. The ... the Journal of Biological Chemistry . , Nerves ...
Breaking Biology News(10 mins):Trisomy 21: How an extra little chromosome throws the entire genome off balance 2Trisomy 21: How an extra little chromosome throws the entire genome off balance 3White House honors Clemson professor as 'Champion of Change' for solar deployment 2Structure of sodium channels different than previously believed 2
Other Tags
architectsbeaverrunawaycaspaseclindamycinplentifulpertussisimmunogenicityallergenillnessessupplementsherbalprofessorshipbassetspaceddocument