Tag: "feeling" at biology news

2007 EURYI: 20 young researchers to receive Nobel Prize-sized awards for breakthrough ideas

...s included, added Dr. Marks. It is also with mixed feeling to acknowledge this would be the last EURYI awards, at least in its present form, that will be co-organised by EuroHORCs (European Heads of Research Councils) and the ESF. The future for this type of award will now be determined by the European Commi...

Faster-acting antidepressants closer to becoming a reality

...epressive disorder. During the long wait to begin feeling the effects of conventional medications, patients ...s for the long time it takes for patients to begin feeling better with the conventional medications. While ketamine appears to achieve this, it is an unlik...

Chronically sleep deprived? You can't make up for lost sleep

...nctions. Sleep-restricted people also reported not feeling sleepy even though their performance on tasks declined. The Northwestern teams results suggest that animals may undergo a change in their need for sleep, or in their sleep homeostat, in situations where normal sleep time is prohibited or where slee...

Hormone that signals fullness also curbs fast food consumption and tendency to binge eat

...ic form of a hormone previously found to produce a feeling of fullness when eating and reduce body weight, al...tide participants did not experience the increased feeling of hunger and food craving that often occurs when food intake is reduced with dieting, Weyer said ...

University of Arizona neurobiologist John Hildebrand elected to the National Academy of Sciences

...cademy, Hildebrand said, "I was stunned. I've been feeling awfully good for the past week. I'm proud at having done well enough to make it. "Any honor like this to the head of a lab is really an honor to the whole group. I am very happy for my field and for the U of A and my lab as much as I am for myself....

How does soy promote weight loss? University of Illinois scientist finds another clue

...eves soy contains anorectic peptides that signal a feeling of satiety as well as peptides that boost the metabolism. Her next step will be to fractionate and purify the soy hydrolysates so that she can identify each peptide and understand its bioactivity....

Meeting the ethanol challenge: Scientists use supercomputer to target cellulose bottleneck

...in the past two years, and consumers worldwide are feeling the pinch as food prices climb. A far better source is to produce ethanol from cellulose, easing pressure on foo d supplies and yielding greater greenhouse gas benefits. The fibrous part that makes up the bulk of plants, cellulose is the cheapest ...

Kent State University and Summa Health System receive NIH grant to study prehypertension

... tensing and relaxing of muscles to produce a calm feeling and stress reduction. All participants will have their blood pressure regularly monitored throughout the study. Individuals may be eligible for this study if they are between the ages of 30 and 60, their blood pressure is elevated but not yet cat...

A 'traffic light' for neurons means 'go' for improving brain research

Every thought, feeling and action originates from the electrical signals emitted by diverse brain cells enmeshed in a tangle of circuits. At this fundamental level, scientists struggle to explain the mind. Worse yet, they have lacked tools to understand what's going wrong ...

Moral judgment fails without feelings

...ict with a strong utilitarian outcome. It is the feeling of aversion that normally blocks humans from harming each other. Damasio described it as a combination of rejection of the act, but combined with the social emotion of compassion for that particular person. The question is, are the social emotions ...

Blood tests may be possible for mental health conditions

... palpitations, shortness of breath, sweating and a feeling of loss of control or dying -- symptoms that are very similar to heart attack symptoms. "People with panic disorder often end up in the emergency room for heart tests when in fact they have panic disorder. This is just one of the reasons that it wo...

Adult stem cells to repair hearts damaged by severe coronary artery disease investigated

...16 of the 24 total Phase I study subjects reported feeling better with reductions in chest pain and improved exercise capacity during the early stage of the trial. ...

First biomarker for human sleepiness identified in fruit flies

...., assistant professor of neurobiology. "If you're feeling sleepy on your way over the river and through the woods to grandmother's house, it's much better to pull over and find a place where you can sleep for a while than to continue on and risk a serious accident." The study appears this week in the onlin...

CGIAR climate change research

...a where large numbers of small farmers are already feeling the bite of climate change-induced water scarcity. Contact: Tushaar Shah, International Water Management Institute Tel: +91 2692 229311 (GMT +5 hours) t.shah@cgiar.org Improving resource-use efficiency Microdoses of fertilizer allow plants to us...

A new target for painkillers

...tive to previously innocuous stimuli for example, feeling pain from a foot rubbing against the inside of a shoe and feel an exaggerated response to things that are painful. Common pain medicines like aspirin, ibuprofen and acetaminophen often fail to relieve neuropathic pain. Morphine-like opiods such as...

Data show treatment with Remicade reduced hospitalizations for ulcerative colitis patients by half

...experience signs of hepatitis B infection, such as feeling unwell, poor appetite, tiredness, fever, skin rash and/or joint pain. There have been rare cases of serious liver injury in people taking REMICADE, some fatal. Tell your doctor if you have liver problems and contact your doctor immediately if you...

New data hint at oncoming cocaine epidemic

...r abuse begins, Gold said. "Cocaine gives them a feeling of incredible mastery, that they are immune to the laws of nature," said Gold, who is affiliated with UF's McKnight Brain Institute. "But it causes consequences. You can't say you are out of the risk window simply by surviving the use event. Death ca...

Food or its expectation sparks brain's hunger centers

...n centers responsible for registering satiety--the feeling of being full or satisfied--switched on almost as soon as food hit their stomachs, Leng said. The new study is the first to chart the sequence of changes in brain activity over the course of a meal, according to the researchers. The researchers pro...

Scientists get best look ever at water-life connection

...o uses nuclear magnetic resonance and so on." "My feeling is that there is no real controversy -- everybody is just looking at the same answer from different angles," he added. The answer, revealed in Zhong's lab: water molecules do move fast on their own, but they slow down -- to a speed midway between th...

News tips from the Journal of Neuroscience

...e Mohr, Christoph M. Michel, and Olaf Blanke The feeling of being in one's body requires neural processing in two separate brain areas: the temporoparietal junction (TPJ), which processes the concept of "self," and the extrastriate body area (EBA), dedicated to recognition of human bodies and even body par...

1 2 3 4

(Date:4/17/2014)... recent Yokahama IPCC meeting painted a stark warning on ... which has a greenhouse effect 32 times that of ... shown that humic substances act as fully regenerable electron ... are held in wetlands instead of being released to ... system is disrupted it may enter into a vicious ...
(Date:4/17/2014)... the genetic information of DNA is used to ... numerous different functions in living organisms. Messenger RNA ... expression, by relating the genetic information of DNA ... , By examining the different types and ... at a given time, researchers can determine which ...
(Date:4/17/2014)... way the immune system may fight cancers and viral ... cells to treat illness. , The research, in mice, ... "neighborhood police" specialized squads of defenders that patrol ... entire city, the body. , Scientists at Washington University ... the liver, skin and uterus each has dedicated immune ...
Breaking Biology News(10 mins):Methane climate change risk suggested by proof of redox cycling of humic substances 2Rapid and accurate mRNA detection in plant tissues 2Some immune cells defend only 1 organ 2
Other Tags
pandoraswettergrasslandsleftieshygieniccapacitiesmusculaturemirnasawaresummitkyotoesabrachytherapyinversetemporarilysue