Tag: "foreign" at biology news

Harvesting machine driving mesquite-to-ethanol potential

...oon. A combination of the U.S.'s dependency on foreign oil and a growingproblem for producers with brush encroachment, which reduces grasses andproduction and water availability, has driven his recent work. "We're emphasizing mesquite and we're targeting ethanol conversion,although there are other bi...

Institute of Medicine elects 65 new members, 5 foreign associates

... Institute honored five individuals by election to foreign associate membership, bringing the total members in that category to 82. With another 68 members holding emeritus status, the total IOM membership is now 1,651. "It is a great pleasure to welcome these distinguished and influential individuals to ...

Venomous cone snail biologist named to Institute of Medicine

... Olivera was among 65 new members and five foreign associates elected to the Institute of Medicine, the organization announced Monday. "It is a great pleasure to welcome these distinguished and influential individuals," said Institute of Medicine President Harvey V. Fineberg. "Members are ...

'Killer' B cells provide new link in the evolution of immunity

... phagocytosis, by which immune system cells ingest foreign particles and microbes. In modern mammals, the B... other things, the creation of antibodies that tag foreign particles and microbes for destruction. "When examining fish B cells we see them actively attackin...

Flemish biotechnology is flourishing

...e to start up new Flemish companies and to attract foreign companies to Flanders. The new bio-incubator provi...to young, starting Flemish companies as well as to foreign companies that want to establish themselves in Flanders. The first bio-incubator dates from 2000, an...

International team analyzes human genetic variation in key immune region

...ed by an individual's immune system to distinguish foreign tissues from "self" tissues and the genes' DNA sequences are frequently analyzed (a process called "HLA typing") in patients who receive organ transplants or suffer from autoimmune disease. Importantly, the researchers' data and analyses, which are...

'Killer' B cells demonstrate evolutionary link between fish and mammal immune systems

...process by which cells of the immune system ingest foreign particles and microbes. The finding, which appear... B cells we see them actively attacking and eating foreign bodies, which is a behavior that, according to the current dogma, just shouldn't happen in B cells,"...

What's next for gene therapy? Plastic

..., Va., Sept. 13, 2006 -- Gene therapy depends upon foreign DNA, even viruses, to deliver genes, therapeutic proteins, or medicine to cells within the body. Many scientists are looking for better chaperones across the cell membrane. Virginia Tech researchers think polymer molecules can be created to do the j...

Protein splicing upsets the DNA colinearity paradigm

...asomes,' components of the cell machinery that cut foreign proteins into peptides that are then displayed on the cell surface for recognition and destruction by CD8+ T lymphocytes. However, the Belgium/USA team has found that proteasomes can also splice the peptide fragments together in a reverse order to th...

Study illuminates how the plague bacteria causes disease

...cells of the immune system to track down and "eat" foreign invaders, the researchers explained. The discovery marks the second way in which this protein, called YpkA, compromises the immune system. Earlier studies suggested that another portion of YpkA--which may have been derived from a mammalian enzyme a...

Fishing trade helps Africa

...rkets, especially in Europe, are a major source of foreign exchange revenue. The fish export trade also helps to underpin the operation of domestic fisheries, which provide a basis for the livelihoods and employment of thousands of local people, mainly in coastal regions. The export trade from West Africa ...

UCLA study uncovers new risk factor for schizophrenia

...inguish the body's own proteins from those made by foreign invaders, such as viruses and bacteria. The developing fetus inherits one copy of the HLA-B gene from each parent. "Our findings clearly suggest that schizophrenia risk rises, especially in daughters, when the child's HLA-B gene too closely match...

A 'recent' embosymbiont -- a rare evolutionary example -- offers clues to how plants came to be

...d endosymbiont and led to the establishment of the foreign cell as a permanent photosynthetic organelle. Prior data indicated a recent plastid endosymbiosis in Paulinella, but lacked information about the properties of the plastid genome. In the new work, Dr. Bhattacharya and colleagues generated DNA libra...

Impact of forest certification in developing countries examined

... since the bulk of their products are destined for foreign markets. Critical findings from the book emphasize a need for the increased commercial support of forest certification, as firms undergoing the process are required to undertake critical improvements in their environmental and social practices. ...

Fight weeds with plant pathogens

...iocontrol approach uses a pathogen imported from a foreign location to control a native or naturalized weed with minimal technological manipulations. "Classical biological control using imported pathogens has an overall success rate of 57 percent and has been just as successful as the use of imported inse...

LIAI scientists identify immune system trigger for fighting Lyme disease

...onenberg said. Most white blood cells respond to foreign proteins to protect the body, but NK T cells are unique in that they respond to glycolipids, which are natural biochemicals made of linked fat and sugar. Prior to Kronenberg's findings, only one compound, developed by the Kirin Pharmaceutical Resear...

Contagious cancer in dogs confirmed; origins traced to wolves centuries ago

...like there is an aggressive phase of growth as the foreign tumor initially isn't recognized by the immune system," Murgia said. "In the long run, the immune system gets the better of it." "As a sexually transmitted cell, CTVT would not have been able to colonize dogs worldwide if it killed them too quickly...

A single sugar found responsible for an antibody's ability to treat inflammation

... of the immune response to identify and deactivate foreign invaders. When they begin attacking the body's own...switch occurs during a normal immune response to a foreign substance, shifting the IgG antibodies from an anti-inflammatory state to one that is pro-inflammato...

JCI table of contents: August 1, 2006

...volve Toll-like receptors, which usually recognize foreign pathogens and trigger immune cell responses. In an accompanying commentary, Laurie Glimcher from Harvard Medical School comments that, "the study of the physiological function of IL-1beta in human gouty inflammation will undoubtedly provide new thera...

Sunnybrook researchers identify which sets of molecules are required to induce T cells

...bility to orchestrate immunity to a broad range of foreign molecules; experiments in mice have shown that gamma-delta T cell injections can eliminate cancerous tumours, although much work remains to translate this research into viable clinical therapy. Ziga-Pflcker was recently identified by the prestigiou...

1 2 3 4 5 6 7 8 9 10

(Date:6/17/2013)... 2013 An international team led by scientists at ... Institute and Albert Einstein College of Medicine of Yeshiva ... that attacks the tuberculosis (TB) bacterium in two different ... solve one of the major global health crises of ... strains," said Peter G. Schultz, the Scripps Family Chair ...
(Date:6/17/2013)... ST. LOUIS -- In research published in Biochemical ... describe a technology that can detect new, previously unknown ... for viruses even when doctors have not identified a ... , In the new approach, scientists use ... discover viruses. , Taking advantage of the complete deciphering ...
(Date:6/17/2013)... early onset of puberty in girls, a new clinical ... Endocrine Society,s 95th Annual Meeting in San Francisco. , ... 10 and 14. Boys undergo these changes later, usually ... is diagnosed in girls when sexual development begins before ... when these changes occur before age 9. , Recently, ...
Breaking Biology News(10 mins):New compound excels at killing persistent and drug-resistant tuberculosis 2New compound excels at killing persistent and drug-resistant tuberculosis 3New compound excels at killing persistent and drug-resistant tuberculosis 4Saint Louis University researchers discover a way to detect new viruses 2Saint Louis University researchers discover a way to detect new viruses 3Vitamin D supplementation may delay precocious puberty in girls 2
Other Tags
capillarymaterialisemisshapentacticsoupamchitkapassivelawnsstaraffirmsmelodyunbornregretbeverageassurefao