Tag: "functionally" at biology news

Researchers map out networks that determine cell fate

...id progenitors, each type relies on its own set of functionally active genes to carry out its particular role in fighting infection. A major scientific puzzle has been how and why immature hematopoietic stem cells initially express genes that are characteristic of both cell lineages. Until recently, however, t...

Research team to analyze brain changes in schizophrenia

...be is one of the primary brain regions known to be functionally altered in schizophrenia," said Hemby, associate professor of physiology and pharmacology. Changes in gene and proteins in this region have "a profound and significant influence on brain function." Schizophrenia is a devastating mental illness affect...

First human study confirms that immune cells can be a primary cause of bone loss in gum disease

...and B cells in the patient's gingival tissues were functionally sufficiently potent to induce bone destructive cells (osteoclasts) in a laboratory culture system, in spite of the elevated presence of B and T lymphocytes. Since it has never been reported that any bacteria per se invade and resorb bone independent ...

Jefferson scientists explain cancer cell metabolism changes

...at coordinated both functions. This shows both are functionally linked by a common gene." "If we have therapies that target changes in metabolism, it allows us to develop therapies selective for the cancerous cells only," says Dr. Pestell. ...

DNA to the defense

...es scientists' general view of how a chromosome is functionally organized. An article describing the research will appear online this week in the journal Genome Research . African sleeping sickness, or trypanosomiasis, is caused by a protozoan parasite known as Trypanosoma brucei . Endemic to sub-Saharan Af...

Pure novelty spurs the brain

...exerts a major influence on learning because it is functionally linked to both the hippocampus, which is the brain's learning center, and the amygdala, the center for processing emotional information. Now, researchers Nico Bunzeck and Emrah Dzel report studies with humans showing that the SN/VTA does respond to...

Scientists discover a genetic code for organizing DNA within the nucleus

...tes on the DNA, as opposed to the many similar but functionally irrelevant sites along the genomic sequence? The short binding sites themselves do not contain enough information for the transcription factors to discern between them. The scientists showed that basic information on the functional relevance of a bin...

Life cycle of operons yields new look at bacterial genetics

...n. "This also explains why operons tend to contain functionally related genes and why genome rearrangements that w... in their PLoS paper. "New operons often comprise functionally unrelated genes that were already in proximity before the operon formed." Arkin, Price and Alm use...

A candidate gene for familial idiopathic pulmonary fibrosis identified

...engulfment, and cell migration. It is expressed in functionally relevant tissue, in lung and in fibroblasts, and its expression is significantly decreased in IPF lung compared to healthy lung.Therefore ELMOD2 becomes a prime candidate gene for familial IPF....

Speeding discovery of the 'human cancer genome'

...lanoma, the most serious form of skin cancer. Such functionally important genes, and the larger genetic pathways o... areas of chromosomal alteration, what changes are functionally relevant." The difficulty stems from the fact that studies that scan the genomes of human tumors f...

Adult stem cell research at UB targets damaged hearts

...tion by down-regulating metabolism while remaining functionally viable. Previous work in UB's Center for Cardiovascular Research employing the center's novel swine model of hibernating myocardium has shown that restoring normal blood flow to these "hibernating" regions improves function. However, these results ...

Scientists tie several cancers to common 'oncogene engine'

...rs share this central family of oncogenes that are functionally interchangeable," said Fisher, who is also a professor of pediatrics at Harvard Medical School. His team demonstrated this point by showing that when tumors in mice were shrunk by disabling one of the transcription factors, replacing it with another ...

Leptin found to control appetite and limb development in frogs

...ities of leptin, the frog protein turned out to be functionally very similar to the human version, Denver notes. "It would appear that leptin and its role as an energy balance indicator has been around a long time," Denver said. "Leptin's other roles in animal development are just beginning to be understood."...

Fly's courtship sheds light on the formation of innate behaviors

...less is known to generate a variety of similar but functionally different proteins, some of which are exclusively expressed in male flies. Using a mutant that specifically disrupts one form of the Fruitless protein, the researchers showed that the male fly's sexual behavior is not a closed neural circuit, but rat...

Malaria, potato famine pathogen share surprising trait

...e if the sequences were not just similar, but also functionally the same," he said. "It turned out that they were. But although the mechanism of getting virulence proteins into a host cell is very similar, the infection-causing proteins that are delivered to a host are completely different." To Kamoun's knowledge...

News tips from The Journal of Neuroscience

...P) on one apoE allele and leaving the other allele functionally intact. As expected, hepatocytes and macrophages expressed high levels of apoE. Approximately 75% of astrocytes expressed apoE under normal conditions, and even after kainic acid-induced injury, a subset did not express EGFP. In contrast, only a smal...

Mobile DNA part of evolution's toolbox

...d over evolutionary time, indicating that they are functionally important. But relatively few of the copies contain parts that code for proteins, which suggests they instead are helping to regulate when genes are turned on and off. Furthermore, when Bejerano analyzed the locations of the copies, he found that th...

DARPA grant supports research toward realizing tissue regeneration

...ould be to see, if following blastema formation, a functionally normal limb or digit develops. If we can achieve full restoration of function in a mouse or other mammal, it would seem feasible that we would be able to learn from this process and enhance the capacity for more efficient tissue restoration and wound...

Mutation in blood stem cells provides clues to cancer development

...ich the body's blood cells become structurally and functionally specialized. The scientists discovered that a mutation in the JAK2 signaling pathway allows the cells to bypass the body's usual mechanism of red blood-cell production, the binding of the hormone erythropoietin (EPO) to its receptor, a process which...

Prediction of a prokaryotic RNA-silencing system

...as unwinding and cleaving. These proteins might be functionally similar to eukaryotic enzymes involved in the RNA-interference system Makarova et al. identify an analog to the eukaryotic RNAi protein Dicer and several potential analogs to the eukaryotic RNAi protein Slicer. But they are not homologous to Dicer a...

1 2 3 4 5

(Date:4/17/2014)... recent Yokahama IPCC meeting painted a stark warning on ... which has a greenhouse effect 32 times that of ... shown that humic substances act as fully regenerable electron ... are held in wetlands instead of being released to ... system is disrupted it may enter into a vicious ...
(Date:4/17/2014)... the genetic information of DNA is used to ... numerous different functions in living organisms. Messenger RNA ... expression, by relating the genetic information of DNA ... , By examining the different types and ... at a given time, researchers can determine which ...
(Date:4/17/2014)... way the immune system may fight cancers and viral ... cells to treat illness. , The research, in mice, ... "neighborhood police" specialized squads of defenders that patrol ... entire city, the body. , Scientists at Washington University ... the liver, skin and uterus each has dedicated immune ...
Breaking Biology News(10 mins):Methane climate change risk suggested by proof of redox cycling of humic substances 2Rapid and accurate mRNA detection in plant tissues 2Some immune cells defend only 1 organ 2
Other Tags
pandoraswettergrasslandsleftieshygieniccapacitiesmusculaturemirnasawaresummitkyotoesabrachytherapyinversetemporarilysue