Tag: "gravity" at biology news

Universe's stringy birth revealed by young Czech scientist in EURYI winning project

...her. It is important in the regimes where quantum gravity is important, such as black holes and the beginning of the universe, added Schnabl. In both cases, dimensions can be small, requiring quantum mechanics, but energies and mass are enormous, creating huge gravitational fields that currently can only be...

Unraveling the physics of DNA's double helix

...th of a Newton. For a sense of scale, the force of gravity on a two-liter bottle of soda is about 20 Newtons, Marszalek noted. They captured the range of stacking forces by measuring two types of synthetic DNA strands: some made up only of the base thymine, which is known to have the weakest attraction be...

Homestake strikes gold again

...studies of nuclear astrophysics, future generation gravity wave detectors, geoneutrino and solar neutrino experiments. Scientists at SUSEL will also get a closer than ever look at the earths crust and new opportunities for monitoring the movement of groundwater. In addition, they will be able to examine the...

Coaching computer canines in clambering

...on of every foot placement such that the center of gravity follows a stable trajectory." To do this, the robot calculates where and how it should proceed, "based on the current position, velocity, and acceleration" of its legs. If one effort fails, the dog learns from its mistakes and tries another route ...

Brain's inertial navigation system pinpointed

... from the semicircular canal in the inner ear with gravity signals. They concentrated their search for the brains inertial navigation system on particular types of neurons, called Purkinje cells, in a region of the cerebellum known to receive signals from the vestibular system. This region is known as the po...

ESA's water mission instrument passes test program

...asuring its overall weight, locating the centre of gravity and the inertia around its three principle axes. These values are crucial for both tuning the launcher trajectory and as input for the satellite's Attitude and Orbit Control System. Noise The instrument module consists of a central structure and...

QUT microgravity tower attracts global scientific community

... QUT a global leader in research on the effects of gravity in many research disciplines. Already the microg...ts into phenomena not able to be studied in normal gravity since the effects of buoyancy, sedimentation and other convective disturbances are not present in gr...

Simulations unravel outer membrane transport mechanism

...cond simulation exerted a force near the center of gravity of the luminal domain, pulling it out of the barrel in one piece. This required an enormous input of energy, however. The force that we applied was about 4,000 picoNewtons, Tajkhorshid said. This is an order of magnitude higher than that required t...

Lessons from the orangutans: Upright walking may have begun in the trees

...es with their toes and distributed their center of gravity more effectively, while keeping one or both of their long arms free to reach for fruits and other supports. Orangutans also keep their legs straight while standing on bending branches, the authors report. The exact benefit of the straight legs is ...

Work with nanoparticles may lead to 'on-the-spot' virus detector

...rk with microscopic objects dispersed in a liquid, gravity is very important," explained Alexandridis. "But at the nanoscale, gravity doesnt matter. So when you are trying to manipulate matter at the nanoscale, electrical fields and f...

FSU pushing boundaries with environmentally friendly community

...ing aerobic treatment units instead of traditional gravity collection systems. Such a system also would enable the treatment of effluent that then could be used within the community for agricultural or landscaping use. "The plan is to build 25 homes that utilize these technologies, collect and analyze th...

AGU Journal Highlights -- April 16, 2007

1. Earthquake-induced gravity field changes slowly recover to initial conditions Earthquakes can modify the Earth's gravity field by deforming the Earth's layers and by changing the density of rocks through dilation and comp...

Disease can be our ally, not just our enemy, says new book by UCR evolutionary biologist

...ortance of disease in our lives by considering how gravity has shaped our evolution. "Gravity makes us break our bones when we fall and our body parts droop with age, but in a weightless environment we dont function very well either," she said. "Like it or not, we evolved with gravity, and we evolved with d...

Magnetic resonance microscopy research lands professor NSF award

...t people know them, change: water can flow against gravity and molecules can stretch. "Fluids behave very differently at small levels," Codd said. "We are able to create computer simulations based on physics about how fluids behave, but with MRM we can see inside objects to see if those simulations are cor...

Walking tall: UH student working on space suit redesign for NASA

...ysiology (LIP). The apparatus is used as a reduced gravity simulator that helps to evaluate locomotion stability. A subject is buckled into the suspension system and simply walks as Scott-Pandorf records data about the person's gait. With this system, she can investigate how mass distribution and pressure le...

CU-Boulder space station experiments to involve K-12 students around the globe

...ome classrooms will track the effects of near zero gravity on the germination of radish and alfalfa seeds orb...n, comparing the effects to seeds bound by Earth's gravity sprouting simultaneously in their own schools, said Stodieck. Other students will focus on a group ...

Scrap tires can be used to filter wastewater

...uatic life. For traditional wastewater filtration, gravity downflow granular filters using sand or anthracite as a medium are commonly used. One major problem with these filters is that upon backwashing the particles, the larger ones settle at a greater rate than the smaller. The Penn State researcher expla...

Researchers show that veins stiffen as we age

... valves to prevent any backflow of blood caused by gravity as blood is returned to the heart from the lower extremities. The walls of the veins are made of collagen and elastin, two proteins that give the tube-like blood vessels flexibility and help them to maintain your blood pressure. To determine if ther...

MIT engineers probe spiders' polymer art

...e their hind legs as well as their body weight and gravity to elongate the gel into a fine thread. Kojic, who first practiced on silkworms, learned how to extract a microscopic amount of the gel-like solution from the spider's silk-producing major ampullate gland. The researchers used devices called micro...

New biochip helps study living cells, may speed drug development

...r the Gulf of Mexico, going from two times Earth's gravity to zero gravity again and again," he said. "There is absolutely no way this experiment could have been done without ...

1 2 3 4

(Date:4/18/2014)... wildlife while feeding a world population predicted to ... holistic approach to conservation that considers human-altered landscapes ... Wildlife and the natural habitat that supports it ... world where at least three-quarters of the land ... rest is vulnerable to human-caused impacts such as ...
(Date:4/18/2014)... Seeds that sprout as soon as they,re planted may ... to be more careful. In the wild, a plant whose ... would risk disaster. More than just an insurance policy against ... seed dormancy has long-term advantages too: Plants whose seeds ... to more species, finds in a team of researchers working ...
(Date:4/17/2014)... COLUMBIA, Mo. April 17 In the most densely ... States, forests reflect two centuries of human needs, values ... logging and clearing forests for agriculture and development, have ... today, a U.S. Forest Service study reports. , The ... forest conditions and management needs in the Northern United ...
Breaking Biology News(10 mins):Stanford researchers rethink 'natural' habitat for wildlife 2Stanford researchers rethink 'natural' habitat for wildlife 3Stanford researchers rethink 'natural' habitat for wildlife 4Plants with dormant seeds give rise to more species 2Five anthropogenic factors that will radically alter northern forests in 50 years 2Five anthropogenic factors that will radically alter northern forests in 50 years 3
Other Tags
greatlyrumorsintegrityoctopussecretsbacteriumanthraxpotentialscreendefencesevadeshieldlovedincapacitatedwishespacemaker