Tag: "hold" at biology news

Taking 'chips' to the next level of gene hunting

...n on them all DNA sequences. Because each chip can hold thousands of these dots - even a whole genome's wo...rossword puzzle. Boeke's new double-capacity chips hold two layers of dots, a bottom layer that reads across and a top layer that reads down, again using th...

Scientific American names UCSB professor, alumna to list of Top 50 in Technological Leadership

...tions in research, business, and policymaking that hold special promise for science and technology. John Rennie, editor in chief of Scientific American, said of those cited by the magazine: "Not only are their achievements facilitating advances in science and technology, they also have broader significanc...

Math model could aid study of collagen ailments

...ay of thinking about biological matter, and it may hold the key to engineering biological systems as we design man-made devices today." The next step in the research will be to delve deeper into the structure of collagen. "We've developed a reference point for healthy collagen. This enables us now to stu...

Plant-derived molecules, genetic manipulation point to future chemoprevention methods

...unds was particularly powerful. This synergy could hold the key to prevention of breast cancer and should be considered for future clinical trials." Genetic reduction of circulating insulin-like growth factor (IGF)-1 inhibits azoxymethane-induced colon tumorigenesis in mice Mice with a genetic alterat...

St. Joseph's provides tissue processing services to researchers in hopes of finding a cure

...uman specimens for study. The frozen specimens may hold the key to advancing the treatment of many diseases such as brain tumors and neurovascular disorders. Scientists at St. Joseph's, T-Gen and other research centers across the country can request HSPS specimens for use in approved research projects....

Early Earth haze may have spurred life, says University of Colorado study

...s believe the atmospheric chemistry of Titan might hold valuable clues to understanding the climate on Earth when life was just forming, said Trainer. Titan is an unusual solar system moon in that it has an atmosphere -- in this case one thick with organic aerosol particles that form through photochemic...

Hundreds of thousands of viral species present in the world's oceans

...t, the researchers predict that the world's oceans hold a few hundred thousand broadly distributed viral species, with some species-rich regions likely harboring the majority of these species....

Deakin University discovery could lead to new leukaemia treatments

...ty scientists have identified a protein that could hold the key to new leukaemia treatments. The protein--Stat5--was investigated at a laboratory at Deakin's Melbourne Campus at Burwood, as part of a multicentre international collaboration. Leukaemia is a cancer caused by a proliferation of white bloo...

Accelerating loss of ocean species threatens human well-being

... While the data show that ocean ecosystems still hold great ability to rebound, the current global trend projects the collapse of all species of wild seafood that are currently fished by the year 2050 (collapse is defined as 90 percent depletion). Collapses are also hastened by the decline in overall ...

Beetle feet stick to their promises

...d that five square centimeters of the material can hold objects weighing up to one hundred grams on walls. However, this limit is much lower for ceilings. Smooth structures, such as glass or polished wood, are good bases but woodchip wallpaper is not very suitable. "Insects also find it difficult to trave...

Stem cells engage in dialogue with the cells that regulate their futures

...stem cells." Ruohola-Baker added that stem cells hold high hope in regenerative medicine: tapping into the ways cells repair the body to create therapies to fix or replace injured tissues. She mentioned that it is thought that most, if not all, adult tissues contain stem cells. Through self-renewing d...

Accelerating loss of ocean species threatens human well-being

... is that the data show that ocean ecosystems still hold great ability to rebound. However, the current global trend is a serious concern: it projects the collapse of all species of wild seafood that are currently fished by the year 2050 (collapse is defined as 90% depletion). Collapses are also hastened...

Research linking Ashkenazi Jews and breast cancer genes beset by problems

...effects," the idea that genetic mutations can take hold and spread within small, geographically isolated populations, such as a group living alone on an island. Although Ashkenazi Jews were never geographically isolated, Rothman said that "researchers made persecution--the pogroms and massacres in Jewis...

Predicting PET imaging's future: Diagnosing and treating diseases ASAP

...ologies," said Cherry. The future of PET/MRI is on hold until researchers master the technological complexity of combining PET detectors with relatively high magnetic fields and overcome economic considerations (this technique will initially be expensive in a financially restricted health care setting)....

Microbes compete with animals for food by making it stink

...pecially in marine ecosystems. "Microbes that can hold onto these resources and use them for their own growth would be advantaged over microbes that could not prevent their resource from being consumed by animals," Hay added. "If microbes could produce chemicals that prevented crabs or fishes from using ...

Turmeric prevents experimental rheumatoid arthritis, bone loss, University of Arizona study shows

...pice, long used in traditional Asian medicine, may hold promise for the prevention of both rheumatoid arthritis and osteoporosis, according to a recently completed study at The University of Arizona College of Medicine. Turmeric, the spice that flavors and gives its yellow color to many curries and othe...

New study warns against linking ethnic identity to breast cancer genes

...effects," the idea that genetic mutations can take hold and spread within small, geographically isolated populations, such as a group living alone on an island. Although Ashkenazi Jews were never geographically isolated, Rothman said that "researchers made persecution--the pogroms and massacres in Jew...

Fat stem cells being studied as option for breast reconstruction

... treat disease or regenerate tissue is believed to hold promise because of their potential to develop into different specialized cell types. Indeed, when exposed to specific conditions in the laboratory, fat-derived stem cells have been shown to differentiate into cells characteristic of those from tissue...

Always keeping a safe distance

...any nanometers from the microtubule does kinesin-1 hold the load during transport? Does this perhaps have anything to do with the previously unexplained role of the section between head and tail? Naturally, it is not possible to simply measure nanometers with a ruler. For the scientists working at the M...

ACS News Service Weekly PressPac -- Oct. 18, 2006

...urst into flame if ignited. Known hydrate deposits hold enough natural gas to supply the world for centuries. One barrier to exploiting this treasure has been difficulty in making gas hydrates in the laboratory that could be used for research on ways to utilize these substances as a fuel. Akihiro Yamas...

1 2 3 4 5 6 7 8 9 10

(Date:8/28/2014)... -- Scientists have identified the developmental on-off switch for ... produce more than two-thirds of the world,s naturally derived ... to see whether it is possible to manipulate this ... , The study, appearing August 28 in Cell ... molecule called cyclic-di-GMP and a larger protein called BldD ...
(Date:8/28/2014)... method for measuring and imaging how quickly blood flows ... understand how drug abuse affects the brain, which may ... lead to better treatment options for recovering drug addicts. ... from Stony Brook University in New York, USA and ... in The Optical Society,s (OSA) open-access journal ...
(Date:8/28/2014)... the first person to alert the world to Global ... be captured and stored underground. He says that Carbon ... the best way to avoid global warming getting out ... (Columbia University, New York) made the call during his ... where 150 scientists are meeting to discuss Carbon Capture ...
Breaking Biology News(10 mins):Small molecule acts as on-off switch for nature's antibiotic factory 2Small molecule acts as on-off switch for nature's antibiotic factory 3This is your brain's blood vessels on drugs 2This is your brain's blood vessels on drugs 3Global warming pioneer calls for CO2 to be taken from atmosphere and stored underground 2
Other Tags
speedycootsovulationperimenopausalpeeksgenesystemsstrepasidewallsbumpdegradationimmunitiesbrandedpolymerpurduesexes