Tag: "identifies" at biology news

Yale scientists find cooperative RNA switches in nature

...Research at Yale reported in the journal Science identifies a new riboswitch (RNA regulatory sequence) class in bacteria that operates as a rare "ON" switch for genetic regulation of the three proteins in a glycine processing system. "This seems like something only a biochemist can appreciate, but what it rea...

US Agency for International Development awards $34 million to Virginia Tech

...illion-a-year olive crop in California. IPM identifies and targets crop pests such as invasive pests, insect-transmitted plant viruses, and harmful native pests, using a combination of tactics, including crop management, biological controls, and limited use of pesticides, to reduce both costs and ecologi...

Scientists identify new cause of obesity

... influence appetite in a second way. The discovery identifies a potential new target for drugs against obesity. Earlier research has shown that this protein, called MC4R, is a receptor on neurons in the hypothalamus region of the brain and receives signals through at least two pathways about the status of the b...

One-way processes speed degradation of coral reefs

...rrent efforts to halt continuing losses. Birkeland identifies seven ecological ratchets that seem to contribute to the loss of coral reefs, including a decrease of corals' reproductive success that may occur at lower population densities, the disproportionate survival of coral predators, and the ability of alga...

Initial sensor for p53 tumor-suppressing pathway identified

...s at The Wistar Institute, the sensor protein that identifies DNA breaks and activates the p53 cell-death program has been identified. Additionally, structural analysis of the protein and its interactions with DNA has revealed the specific mechanism by which the protein detects the breaks. The study will be pub...

Scientists uncover secret to sharp teeth

...lished in the November issue of Developmental Cell identifies a molecular mechanism that controls the precise patterning of enamel formation on incisor teeth. Mouse incisors are covered with enamel on the side closest to the lip while the side facing the tongue remains enamel-free. This irregular distribution...

MIDI, Inc receives Official Methods(SM) status for the confirmatory ID of the anthrax pathogen

...is. The Sherlock Microbial Identification System identifies over 1,500 species of bacteriaby automated analysis of the fatty acids in the bacterial cell membrane. The bacteria are identified by comparing their fatty acid "fingerprint" to databases of known fatty acid patterns. The system includes several ba...

IRCM scientist demonstrates basic active mechanism of immune-system cells

...vanced tissue damage. Dr. Veillette's breakthrough identifies a cascade of molecular reactions involved in this type of damage, providing new therapeutic targets that could be used to reduce attacks on the pancreas in juvenile diabetes, on the kidneys in lupus, and on the joints in rheumatoid arthritis. ...

Study identifies molecular complex vital to creation of miRNAs

...new study from researchers at The Wistar Institute identifies for the first time a molecular complex vital for the creation of miRNAs. This complex, dubbed the microprocessor complex, contains two proteins, one of which has been linked to DiGeorge syndrome, the most common disorder of genetic deletion in humans...

New report offers recommendations to spur interdisciplinary research

...report from the National Academies. "This report identifies steps that individuals and institutions can take to more effectively conduct, facilitate, and evaluate interdisciplinary research programs and projects," said Nancy Andreasen, co-chair of the committee that wrote the report, Andrew H. Woods Chair of ...

Studies in Royal Society journals include stress in birds and depletion of medieval fish stocks

...rs later, and fewer birds show symptoms.This paper identifies a number of potentially important conditions that could cause this behaviour. For the model to generate seasonal variation in disease prevalence that mimics the observed data, some birds must gain partial immunity, recover from the disease, breed sea...

Columbia researchers identify drug as therapeutic candidate for spinal muscular atrophy

...ing experiment. Additionally, SLIMS automatically identifies and corrects the systematic errors that are common with the robotic technologies used in screening. ...

New pheromone creates buzz about the clout of older bees

...ndle the demands of buzzing about. The work that identifies the chemical, "Regulation of Behavioral Maturation in Honey Bees by a New Primer Pheromone" is publishing in Proceedings of the National Academy of Science Biological Sciences, Population Biology, Early Edition the week of Nov. 29. "If the older one...

UT Southwestern researchers trace how virus that causes AIDS spreads following oral exposure

... to the virus. Researchers hope the study further identifies one of the major problems facing the formulation of a vaccine: any vaccine needs to overcome the rapid spread of the virus from the site of infections to tissues throughout the body. The study was funded by the National Institutes of Health Institut...

Next edition of textbook ushers cellular microbiology out of infancy

... Coined in 1996, the term "cellular microbiology" identifies an emerging discipline that integrates the fields of cell biology and microbiology, highlighting the interaction between microbes and host cells. The advent of genomics, proteomics and postgenomics has resulted in more widespread understanding of th...

Study reveals developing countries with recipe for thriving health biotech industries

...rs in detailed case studies of seven countries. It identifies factors that led to their success and the challenges that remain. The key findings underline the importance in developing countries of 1) focusing on local health needs ("necessity becomes opportunity"), 2) the role of the private s...

Study identifies key aspect of immune response against HIV

...assachusetts General Hospital (MGH). "This study identifies the genetic battleground where the struggle between HIV and the human immune response occurs," says Philip Goulder, MD, PhD, of the Partners AIDS Research Center at MGH, the study's principal investigator. "The findings will help in understanding pr...

Genetic defect confers risk of major depression, resistance to SSRI drug therapy

... of the abnormal gene variant. "The current study identifies a functional genetic variant, which leads to a major decline in the production of serotonin and which may be an important risk factor for major depression," said Duke researcher Xiaodong Zhang, Ph.D., lead author of the study. "The findings provide a...

Scientists solve the mystery of how Botox attacks nerves and eliminates wrinkles

...pt its function. But the means by which the enzyme identifies and cleaves its target SNARE has been a subject of much speculation." Now, Brunger and Stanford graduate student Mark A. Breidenbach have solved part of the puzzle. Their results, which will be published in the Dec. 12 online edition of the journal N...

INEEL-designed system assists army with chemical weapon destruction

...ble isotopic neutron spectroscopy system, or PINS, identifies the chemical fill the munition may contain. Operations began with the evaluation of drums containing Chemical Agent Identification Sets, which were produced by the Army from 1928 to 1969. These sets are glass ampules or bottles that contain small am...

1 2 3 4 5 6 7 8 9 10

(Date:5/22/2013)... biodiversity of pollinating insects and wild plants have slowed ... Researchers led by the University of Leeds and the ... of dramatic reductions in the diversity of species in ... 1980s. , But the picture brightened markedly after 1990, ... among bees, hoverflies and wild plants. , ...
(Date:5/21/2013)... shows that the nation,s land and water resources could ... up to 25 billion gallons of algae-based fuel a ... yearly needs. , The findings come from an in-depth ... to grow significant amounts of algae in large, specially ... May 7 issue of Environmental Science and Technology ...
(Date:5/21/2013)... Michigan Water Center today awarded 12 research grants, ... and protection efforts. , The two-year grants of ... efforts to track the remediation of harmful algae ... non-native weedy plant invasions; study chromosomal damage in ... restoration activities. , The grants were awarded to ...
Breaking Biology News(10 mins):Encouraging signs for bee biodiversity 2Encouraging signs for bee biodiversity 3Going green: Nation equipped to grow serious amounts of pond scum for fuel 2Going green: Nation equipped to grow serious amounts of pond scum for fuel 3Going green: Nation equipped to grow serious amounts of pond scum for fuel 4U-M Water Center awards $570K in Great Lakes restoration grants 2U-M Water Center awards $570K in Great Lakes restoration grants 3U-M Water Center awards $570K in Great Lakes restoration grants 4
Other Tags
penniesswallowgabapentinrelievedlocationtanningguardiansleuthresponsibilitywalkspercentagerankingsavoidscoolingminiinvestigated