Tag: "introducing" at biology news

Chromosome rearrangements not as random as believed

... is, sperm or egg cells, there is a possibility of introducing DNA changes. In this study, we asked if some people make those changes at a higher frequency, and found that this appears to be the case." The researchers found that at the site where the translocation would occur, 87 percent of 394 normal chromosome...

CU, USDA team to curb two invasive, poisonous vines

...-ARS research entomologist at Cornell, adding that introducing any agent will require federal approval. "Our research will help guide the selection of an effective agent." Milbrath, whose funding from USDA supports the Cornell collaboration on a three-year project, is working with researchers at a USDA facility ...

Scientists force viruses to evolve as better delivery vehicles for gene therapy

...ganism - the researchers created mutant viruses by introducing small variations in the genes through an error-prone polymerase chain reaction (PCR) coupled with a test tube recombination technique. After reassembling the mutant viruses inside their capsids, they introduced them to blood serum pooled from rabbits...

Molecular force field helps cancer cells defend against attack

...ere able to block FAK from binding with VEGFR-3 by introducing a different protein that stopped cancer cells from dividing and caused them to die but spared normal breast cells. "FAK is a critical molecule, and in the future different ways of targeting either the enzyme itself or targeting the binding between th...

Swiss researchers develop all-in-one remote control gene expression tool

...n, dying cells (such as neurons) can be rescued by introducing a gene that expresses a growth factor. Thanks to the remote control carried in the lentivirus the expression of this growth factor can now be turned off when the desired effect is achieved, thus preventing unharnessed growth otherwise known as cance...

Academy honors 15 for major contributions to science

...u of Shipping, Houston. Liu was chosen "for first introducing finite element techniques into ship design and being the driving force behind the revolution in basing classification society rules on scientific principles." The medal was established by a bequest from William Francis Gibbs and his brother, Frederi...

Scientists lift malaria's cloak of invisibility

...us genes, inserting them into plasmid vectors, and introducing them into red blood cells infected by malaria parasites. In one experiment, they set up a system where var gene expression could be studied using drug selection rather than the immune pressure that is normally needed to select variants in the field....

Algal protein in worm neurons allows remote control of behavior by light

By introducing expression of a special green-algae gene into neur... light sensitivity of the algal channel protein by introducing expression of a modified form of ChR2 in specific C. elegans neurons and muscle cells. The researche...

New small RNAs found

...a second RNAi pathway in Tetrahymena thermophilia introducing a heretofore unprecedented layer of complexity to small RNA biology in unicellular organisms. The researchers describe a distinct class of 23-24-nt small RNAs that accumulate ubiquitously throughout the Tetrahymena life cycle. This novel class of sm...

Carnegie Mellon U. transforms DNA microarrays with standard Internet communications tool

...s at Carnegie Mellon. "We are very excited about introducing this versatile, powerful method to the research community because it can be used to study a wide range of complex, dynamic systems more comprehensively," said Bar-Joseph, who also is a member of the Center for Automated Learning and Discovery at the ...

UF, Columbia scientists closer to new cancer detection method

...dings of the National Academy of Sciences, involve introducing molecularly engineered strands of DNA into cell cultures and observing whether they unleash a fluorescent burst after they adhere to cancer proteins. The technique could enable doctors to search within extremely complex fluid or tissue samples to pi...

Genetic defenders protect crops from fungal disease

...ln disabled the protective genes in Arabidopsis by introducing mutations, one at a time and in various combinations. They infected these mutants with one of two species of powdery mildew: Blumeria graminis hordei, a species that attacks barley, and Erysiphe pisi, one that thrives on the leaves and pods of pea pl...

Reify corporation announces Myosight(tm)

...nd toxicity testing, and we are enthusiastic about introducing Myosight and discussing our technology at AHA this year."...

Grants to fund research on preparing for bioterrorist attack

...d infection. Vaccine makers rely on this quality, introducing weakened versions of a pathogen to the system, so that it develops memory cells ready to turn on the minute the system encounters the more potent, actual disease. Strategies that hold potential to correct anti-TNF immune cell defects include changing...

ECCO 13 - Sunitinib prolongs survival in GIST patients after imatinib mesylate failure

...will change therapy for GIST patients worldwide by introducing a new and effective agent into the physicians' therapeutic armamentarium. We have much to learn about the patients who benefit the most from SU11248 therapy, and we are already working to expand and enhance the ability to manage GIST patients using ...

Biologists discover new pathway into plant cells

...lls by increasing or controlling their growth, or introducing new characteristics....

Combination therapy for mouse model of human inherited blindness

...ng drug-free treatment could be done by surgically introducing gene therapy. This study marks the first step in finding out whether these treatments will work effectively and safely in humans....

Valuing biodiversity services, including its insurance against disease

...ore carbon may be used to slow climate change; How introducing species to a new environment sometimes transplants invasive diseases and other problems. Exotic bee species imported for crop pollination, for example, appear to have also caused the spread of unwelcome new weeds while several species of frogs have ...

UCF researchers to develop water purification system for hurricane relief

...that they become unusable for water treatment. "By introducing nanoparticles into a mobile integrated membrane system, we can create potable water from a variety of sources," said Seal, who also works with the Advanced Materials Processing and Analysis Center. Taylor, who has conducted water treatment research s...

Radical approach to cardiac resynchronization shows promise

...of a revolutionary, minimally invasive approach to introducing an electrical lead to stimulate or pace the heart, taking advantage of heart anatomy," said Hiroshi Ashikaga, a co-author on the paper and head of cardiac electromechanics research in the McVeigh lab. "If the patient doesn't have many veins on the h...

1 2 3 4 5 6 7 8

(Date:5/22/2013)... (NLST) investigators also conclude that the 20 percent ... tomography (LDCT) versus chest X-ray (CXR) screening previously ... at experienced screening centers in the United States. ... with their patients about the benefits and risks ... in the New England Journal of Medicine ...
(Date:5/22/2013)... Harvard physicists have developed a novel technique that can ... a process that is one of the most important, ... described in a paper in Nature , post-doctoral ... Dr. Melanie Schnell of the Center for Free-Electron Laser ... relies on finely-tuned microwave fields to identify molecular variants ...
(Date:5/22/2013)... Md. (May 22, 2013)The omega 3 fatty acids in ... cardiovascular diseaseso much so that the American Heart Association ... a week, particularly fatty varieties rich in omega 3s. ... a mystery. In a new study, scientists led by ... on this phenomenon by providing evidence that fish oil ...
Breaking Biology News(10 mins):NLST: CT detects twice as many lung cancers as X-ray at initial screening exam 2NLST: CT detects twice as many lung cancers as X-ray at initial screening exam 3Detecting mirror molecules 2Detecting mirror molecules 3Fish oil may help the heart beat mental stress 2
Other Tags
reversiblyswitchesmitslittlerappliesspecificityforeveraustraliansrelyfeversovertakemortemscarspresentingpodcastcore