Tag: "keeping" at biology news

Genetic testing could bolster radiotherapy's effectiveness against cancer

... no single protein in the group is responsible for keeping the cancer alive, Li said that the key to a successful assault could rest in a deeper understanding of the relationship among these protein molecules - an understanding that could be made available through genetic testing. "We have discovered that br...

Can money grow on trees? Win-win strategies for 'sustainable bioprospecting'

...gotiations on access and benefit-sharing. "Without keeping in mind the complexities of the economic exchange process, the achievement of goals like new medicines, recognition and benefit-sharing for the communities, conservation of biodiversity and positive economic effects for developing countries from gene...

Brain-mapping technique aids understanding of sleep, wakefulness

...estern found that a type of neuron responsible for keeping animals awake receives inhibitory signals from neu... specific region of the brain are doing just that, keeping the animals asleep." The researchers also found that during wakefulness, orexin neurons activate ce...

Important brain finding results from boy's rare, fatal disease

...t in the world at handling neural precursor cells, keeping them alive and manipulating the signals that the c...le Lacagnina and David Gass, who devoted months to keeping the cells alive and healthy; and Eric Richfield, M.D., Ph.D., a neuropathologist formerly at Rochest...

Brown wins major award to improve environment, protect RI health

...sland Department of Health will serve as advisors, keeping scientists trained on the real-world concerns of h... rapidly relay research results to state agencies, keeping government decisions grounded in good science. "It makes sense to come together to tackle the proble...

Variation in immune response gene causes age-related macular degeneration when triggered

...ation in Factor H strengthens the immune response, keeping infections under control early, but ironically that may contribute to a chronic disease like AMD later in life." The Columbia and Iowa scientists were able to make this connection in large measure by studying a rare form of kidney disease called MPGN...

New tool reveals secrets of migrating cells

...to be able to go into the native environment while keeping the intact organ alive and make movies of migrating cells." With two-photon imaging, Witt and Robey identified thymus cells they dubbed beeliners moving nearly two centimeters - almost an inch - per hour, which is fast in the realm of cell movement. ...

Tollbooth ventilation system effective in protecting workers from traffic air pollution

... the tollbooth ventilation system was effective in keeping air toxins out of the tollbooth and away from the workers. The researchers measured levels of volatile organic compounds (VOCs) and particle-bound polycyclic aromatic hydrocarbons (PAHs) inside and outside the tollbooth and found relatively high leve...

Children at risk, says Illinois agricultural economist who helped assess the world's ecosystem

...ing lower down the food chain. We are catching and keeping species of fish that used to be thrown away because the better species have all but disappeared. "Coastal and river delta areas around the world are suffering from a number of problems, including hypoxia created by effluents entering the river system...

Two new retrovirusestransmitted from animalsidentified

...g and butchering of bushmeat, and in some cases to keeping primates as pets. An analysis of the blood samples determined that multiple simian viruses had crossed over from primates to infect the study participants. In two hunters, the researchers identified HTLV-3 and HTLV-4, the two previously unknown virus...

PNAS highlights for the week of May 16 - 20

...rred during hunting, butchering, and in some cases keeping primates as pets. The researchers found two viruses, HTLV-3 and HTLV-4, both of which belong to a genus of viruses known as deltaretroviruses. Other deltaretroviruses like HTLV-1 cause leukemia and other inflammatory diseases, and HTLV-2 is known to ...

Deeply held values fuel debate over offshore wind power

...ys. "There's the value of protecting the ocean and keeping it free from human intrusion, the value of cleaner air and less human infirmity and mortality, and the value of traditions like sailing and fishing in New England. There's the issue of whether there is a right to a local seascape that residents assum...

Like the famous doughboy, nanotubes give when you poke 'em

...easured tubes with an increasing number of layers, keeping the external radius twice as large as internal rad...ge this ratio and vary the number of layers, while keeping the internal radius constant and vice-versa to see how these changes affect the tubes' elastic prope...

Study finds research participants concerned about genetic discrimination

...ood idea because you might have trouble getting or keeping your insurance." "Despite this concern, people were willing to be tested, and we didn't see any clear sign that this concern was a large deterrent to being tested," added Hall, Fred D. and Elizabeth L. Turnage Professor of Law at Wake Forest Univers...

Study in Royal Society journal on heritability of female orgasm

...risk of colliding with the turbines in the dark by keeping a longer distance to individual turbines. Overall, less than 1% of the ducks and geese fly close enough to the turbines to be at any risk of collision. Contact: Mark Desholm, Department of Wildlife Ecology and Biodiversity, National Environmental R...

Clear rules needed to govern deep sea bioprospecting: UNU

...he legal and policy framework is not even close to keeping pace with the fast-evolving science and technology of deep seabed bioprospecting," says report contributor Sam Johnston, Senior Research Fellow at UNU-IAS. "The international debate still sees governments divided over whether or how to regulate deep ...

Mayan stingless bee keeping: Going, going, gone?

...TRI) warn of the imminent demise of stingless bee keeping on the Yucatan a result of ongoing cultural chang...his rate, we would expect the art of stingless bee keeping to disappear from the Yucatan by 2008." David Roubik, once dubbed "The Bee Man" in a National Geog...

Next level of camera development for molecular/nuclear imaging incorporates PET, CT, SPECT

... help them achieve their research objectives while keeping the flexibility to add modalities as research needs," he added. Imaging systems like this could speed the development of life-saving drugs by allowing researchers to do work faster and more efficiently, he noted....

Scripps scientists identify target of an immune suppression molecule called CD22itself

...acks to honest customers. So the body has ways of keeping the B cells in the bottom of the drawer until a thief comes along. One basic way the body does this is by setting a threshold for B cell activation. Only those B cells with receptors that can bind to the antigen with a certain affinity will become ac...

Is Cajun in the genes?

...ians has been aided by excellent historical record keeping by families and churches. In addition, he said, th...d, thanks to the good family and historical record keeping within the Acadian population, they were able to determine when the new mutation occurred. Since t...

1 2 3 4 5 6 7 8 9 10

(Date:5/21/2013)... battle? Try staying fit in space, where living quarters ... , That,s the challenge a group of Michigan State ... million grant from NASA. Their goal is to keep ... "You could give astronauts the best exercise regimen there ... to it, it isn,t going to help," said project ...
(Date:5/21/2013)... biomass experts , Where? Copenhagen, Denmark: ... 03-07 June 2013 , Why? ... market and policy developments, manufacturing and installation, drawing on ... from its 2013 edition from a record of more ... more than 240 plenary and oral presentations, more than ...
(Date:5/21/2013)... The epigenetic modifications, which alter the way genes ... apparently be detected in the blood of pregnant ... way to foretell depression in the weeks after ... symptoms become debilitating. , The findings of the ... online in the journal Molecular Psychiatry . ...
Breaking Biology News(10 mins):Fueling fitness on the final frontier 221st European Biomass Conference and Exhibition 221st European Biomass Conference and Exhibition 321st European Biomass Conference and Exhibition 4Genetic predictors of postpartum depression uncovered by Hopkins researchers 2Genetic predictors of postpartum depression uncovered by Hopkins researchers 3
Other Tags
deficitmammarymissilesguidedcoloradoinfluencesculturealoneopensdocumentedruinousmethamphtetamineflycheckfacedmetacognition