Tag: "licensed" at biology news

Boston University, Fraunhofer Gesellschaft form alliance to accelerate biomedical innovation

...orking medical devices and instruments that can be licensed to existing companies or created by new, spin-off ventures. The alliance is expected to use another recently funded initiative as a wellspring. Last year, the Wallace H. Coulter Foundation awarded a $4.9 million grant to Boston University to enhanc...

Case Western Reserve University licenses methoxyamine to Tracon

...rapeutics. The patented therapy, which has been licensed to TRACON, has been studied most intensively in combination with the approved chemotherapeutic Temozolomide. Methoxyamine prevents cancer cells from repairing DNA damage caused by chemotherapy, according to Steve Tan, a senior licensing manager in C...

Poultry consumption, handling are risk factors for antibiotic resistance in humans

...elated to quinupristin-dalfopristin, an antibiotic licensed to treat patients with serious, antibiotic-resistant infections. The drug is prescribed under the brand name Synercid.According to Belongia, "There is a relative lack of data on the impact of antibiotic use in livestock and its relationship to antibi...

Carnegie Mellon scientists use 'green' approach to transform plastics manufacturing

...light exposure and other variables. ATRP is being licensed to several companies that have already begun commercial production in the United States, Europe and Japan. But Matyjaszewski says large-scale production of polymers by ATRP has been limited because ATRP previously required a high concentration of cop...

American Andrew Z. Fire shares Nobel Prize for discovering RNAi

...iscovery was recently patented and has been widely licensed in the U.S., Europe, and Japan to address a broad range of research questions. Science magazine identified RNAi as a "Breakthrough of the Year" in its December 2002 issue. As with many scientific discoveries, the research that led to the discovery o...

NIH funds Berkeley Lab research on defense against radiological attack

... development into effective products that could be licensed for use, says program officer Bert Maidment, associate director of product development in NIAID's Division of Allergy, Immunology and Transplantation. In the event of an attack by nuclear explosive device or radiological dirty bomb, people could p...

UCLA neuroscience research leads to a possible treatment for type 1 diabetes

...e insulin-producing cells," Tian explained. UCLA licensed the technology to Diamyd Medical for clinical development. Tobin and Kaufman both serve on the scientific advisory board of Diamyd. Based on the success of the GAD vaccine to prevent diabetes in mice, Diamyd Medical conducted a phase II clinical tr...

Novel biomarker for prediction of survival in colorectal carcinomas revealed

...sue microarray technologies. Developed at Yale and licensed to HistoRx, AQUA can measure protein concentrations within specific cells and cellular compartments in a highly reproducible and unbiased manner, Gustavson said. Working with tissue samples from 518 colorectal cancer patients diagnosed between 1970 ...

New National Institute of Mental Health research program launches autism trials

...e of thimerosal. Thimerosal-free influenza vaccine licensed for use in children six to 23 months of age is available in limited supply. Additionally, new pediatric vaccines that have received licensure do not contain thimerosal. Regardless, many families continue to turn to chelation as a therapy for autism...

New genetic link to cot death identified

...ble infants. In theory, commercially available and licensed human immune serum could be given to those children most at risk." Dr Drucker, whose previous work has also explained why smoking and sleeping position are also risk factors in SIDS, says this latest research will help establish the cause of death ...

Latest enhancements to the free Access Grid Toolkit are now available for download

...compliance with standards and insistence on openly licensed technologies in this new version is a key differentiator for the Access Grid; it delivers free software with significant improvements to the users, while providing a platform for exploring how remote researchers can work together effectively. With t...

Combating anthrax: Results of study published this month as researchers look for a better vaccine

...ormulations, or AVA, the anthrax vaccine currently licensed for use in the United States. All vaccinations were administered intramuscularly....

Producing flu vaccines will be faster and cheaper, thanks to MSU technology

...., a biotechnology company based in Vancouver, has licensed the technology from MSU and plans to produce cell culture-based flu vaccine. "We want to proceed as quickly as possible," said Harmel Rayat, president of HepaLife. "There's no time to waste. Sooner or later the avian flu virus will be in North Amer...

IVF identity fraud: A phenomenon that puts patients, children, and clinics at risk

...veyed 70 Human Fertilisation and Embryology (HFEA) licensed units, including both publicly funded and private clinics, in the UK. 45 responded, of which 37% had experienced or suspected cases of patient identity fraud. Overall, 53% of those surveyed felt that they did not have sufficient safeguards. Met...

Study points to genes responsible for malaria parasite's survival in attempts to eradicate it

...o develop a malaria vaccine, we still don't have a licensed product," says Associate Professor Elizabeth Winzeler of Scripps Research, who led the study. "Our findings may help in the vaccine-development effort, because they point to novel immunogens that could be targeted." Winzeler adds the study also ident...

Daniel Guarasci named SNM Technologist Section Outstanding Educator

...i, a certified nuclear medicine technologist and a licensed pharmacist. Guarasci teaches courses such as "Ra...armaceutical Services at SUNY, all in Buffalo. A licensed medical/health physicist, Guarasci earned a doctorate of pharmacy, a master of science degree in rad...

UK markey cancer center receives FDA approval to test novel cancer drug

...pment and testing, pharmaceutical company Novartis licensed the drug. But after Burke died, the company released its licensing of DB-67, leaving the drug with a dismal future. However, as a pediatric oncologist and director of the Experimental Therapeutics Program at UK HealthCare's Markey Cancer Center, Dr. ...

'Mercury sponge' technology goes from lab to market

...is now available for commercial use. Battelle has licensed the SAMMS technology developed at Pacific Northwest National Laboratory to Steward Environmental Solutions of Chattanooga, Tenn. Battelle operates the laboratory for the Department of Energy and transfers lab-developed technologies to the marketplac...

Bayer HealthCare licenses Genomatix for microarray analysis

Genomatix announced today that Bayer HealthCare licensed Genomatix microarray analysis platform ChipInspect...dies we are now very pleased that Bayer HealthCare licensed ChipInspector. We expect that ChipInspector will enhance the Affymetrix analysis pipeline starting f...

Experts urge industry and international donors to prepare pneumococcal vaccines

...nst seven common strains of the disease is already licensed and in use in over 60 countries and that formulations containing additional serotypes of the organism that are also relevant for developing countries are under development. The WHO considers pneumococcal vaccines to be a priority and recognizes the u...

1 2 3 4 5 6

(Date:4/17/2014)... recent Yokahama IPCC meeting painted a stark warning on ... which has a greenhouse effect 32 times that of ... shown that humic substances act as fully regenerable electron ... are held in wetlands instead of being released to ... system is disrupted it may enter into a vicious ...
(Date:4/17/2014)... the genetic information of DNA is used to ... numerous different functions in living organisms. Messenger RNA ... expression, by relating the genetic information of DNA ... , By examining the different types and ... at a given time, researchers can determine which ...
(Date:4/17/2014)... way the immune system may fight cancers and viral ... cells to treat illness. , The research, in mice, ... "neighborhood police" specialized squads of defenders that patrol ... entire city, the body. , Scientists at Washington University ... the liver, skin and uterus each has dedicated immune ...
Breaking Biology News(10 mins):Methane climate change risk suggested by proof of redox cycling of humic substances 2Rapid and accurate mRNA detection in plant tissues 2Some immune cells defend only 1 organ 2
Other Tags
pandoraswettergrasslandsleftieshygieniccapacitiesmusculaturemirnasawaresummitkyotoesabrachytherapyinversetemporarilysue