Tag: "linked" at biology news

Plant protein mimics hormone that mitigates diabetes and obesity

...imics the activity of a hormone in mammals that is linked to weight loss and is believed to play a role in mitigating heart disease, obesity and diabetes, according to a team of researchers at Purdue University and several collaborating institutions. The research has the potential to lead to a simple screen...

Calcium may protect women from cancer

...mary source of calcium in the U.S. diet, have been linked in some studies to increased risk of prostate cancer." More about the study The 45,354 women in this study were selected from the Breast Cancer Detection Demonstration Project (BCDDP), which was a breast cancer screening program conducted jointly b...

Genetic regions influencing male sexual orientation identified

...Health, found stretches of DNA that appeared to be linked to sexual orientation on three different chromosom...se newly discovered chromosomal sequences that are linked to sexual orientation."...

Recognizing new aneurysm syndrome can save lives

...ndrome's responsible genes had not previously been linked to the syndrome's individual characteristics in people. The dozen or so mutations identified so far reduce the ability of the receptor to bind TGF-beta and transmit its signal, but that's only indirectly the cause of the syndrome, Dietz suggests. "W...

Pro-inflammatory enzyme linked to diabetes; Immune system's macrophages may be key to treatment

...zyme that initiates inflammation has been directly linked to insulin resistance and resulting type II diabetes by researchers at the University of California, San Diego (UCSD) School of Medicine. In addition, the team suggests that inhibition of the enzyme in the immune system's macrophages may be a new di...

Discovery promises simpler therapy for sickle cell disease

...' red blood cells to process nitric oxide has been linked to a disease, the researchers said. The findings also raise the possibility that defective nitric oxide processing by red blood cells may represent a new class of blood diseases. Patients with sickle cell disease have an abnormal form of hemoglobin. ...

New nicotine-like imaging agent holds promise in PET studies, may help diagnose Alzheimer's disease

...ddition, nicotine addiction and lung cancer may be linked to this receptor. The availability of a good PET imaging agent for this receptor will allow preclinical and clinical studies, leading to better understanding of different medical conditions and eventually helping in their diagnosis and treatment, sai...

Gene with broad role also causes prevalent, inherited nerve disorder

...CMT type 1 or 2, Zchner said. Earlier research had linked this "intermediate" form of the disease to unknown...ed three unrelated families, with intermediate CMT linked to one of those chromosomal regions, for defects in candidate disease genes. Family members who had ...

US government list of cancer-causing agents grows

...age at the time of exposure. Childhood exposure is linked to an increased risk for leukemia and thyroid cancer. Exposure during reproductive years increases the risk for breast cancer, and exposure later in life increases risk for lung cancer. Exposure to X-radiation and gamma radiation has also been shown ...

Increased risk of osteoporosis associated with gene that one in five people have

...vious studies showed that some CYP1A1 variants are linked to estrogen-related cancers, such as breast, ovari...f the hip. The CYP1A1 variant that the researchers linked to osteoporosis may be an important genetic marker for evaluating that risk. "Ideally, you want to ...

McGill researchers shed light on formation of carcinogen in food

...s considered dangerous. Although furans have been linked to cancer in experimental animals, there is no direct evidence that furans are human carcinogens. "Even so," says Dr. Yaylayan, "food companies and government agencies are keeping a close eye on the situation. It's important to know exactly what chem...

Cell research signals cancer hope

...rface of the cell known as 'Notch', which has been linked to a form of leukaemia called T-ALL. The Notch receptor, of which there are four types in humans, is unusual in that once it has picked up a signal, it splits into two and part of it actually becomes the signal on its journey to the cell nucleus. Wha...

Bayou blues: Working to save the US from the worst potential oil, gas and fishing crisis

...nd Internet technology scientists in the field are linked with classrooms and educational institutions to allow students to interact with the JASON Expedition team in real time and receive a first-hand look at how real wetlands research is collected. Participating JASON schools around the world are playing...

Grid expectations for networked computing: From global Earth monitoring to black hole detection

... country or even continent they simply have to be linked together. A geographically dispersed or 'distributed' network of computers has the potential to provide users with access to advanced computing services, processing power or memory, enabling the solution of massively complex tasks beyond the capab...

Report addresses safety problem in preharvest stage of food production

...reaks of a number of foodborne illnesses have been linked to contamination occurring in the preharvest stage of food processing. The report recommends creating an accessible international database of genetic sequences for known foodborne pathogens along with new and improved tools for detecting and catalog...

Hypertension in African Americans linked to two genomic regions

...st there have been conflicting reports about genes linked to the condition." In a fresh approach to the problem, the researchers applied a genome-wide scan that compared how often genetic variations occur in people of African or European descent to how often they occur in African Americans. As a group, Af...

JCI Table of Contents, March 1, 2005

...red while decreased IRS-2 levels were more closely linked to changes in the expression of lipid metabolismrelated genes. The authors conclude that IRS-1 and IRS-2 are complementary in the regulation of overall liver metabolism but with differential effects on gluconeogenesis and lipogenesis. This study pro...

Joslin scientists show knocking out two key signals will cause diabetes

...using blood sugar to rise. Low levels of IRS-2 are linked to higher levels of blood fats such as triglycerides. Acting alone, neither causes diabetes. But when both substrates are low, diabetes results. "Our findings show what happens when we knock out these two protein signals, causing conditions to worsen...

Tufts-NEMC researchers identify enzyme that activates cancer cell growth and invasion

...wth of blood vessels. More recently, PAR1 has been linked with the invasive and metastatic properties of many different kinds of cancers, however, it was not known how the receptor was being activated in tumors. "We were surprised to find that the cancer cell itself did not provide the missing protease. We ...

New drug may be formidable adversary for hard to treat leukemia

...e to imatinib in patients with advanced disease is linked to the emergence of additional mutant forms of Bcr-Abl that are not inhibited by imatinib. A group led by Dr. James D. Griffin from the Dana-Farber Cancer Institute working with scientists at Novartis Pharma AG in Switzerland used data obtained from ...

1 2 3 4 5 6 7 8 9 10

(Date:8/21/2014)... , Aug. 21, 2014 /PRNewswire-iReach/ -- ... it has agreed to a partnership with Gabriel ... fastest growing Certified Nursing Assistant ... Health Institute  an exclusive member of Binary,s LiveScan ... Binary Biometrics will improve its service capabilities ...
(Date:8/21/2014)... Nine researchers from Beth Israel Deaconess Medical ... "The World,s Most Influential Scientific Minds 2014," ... Reuters ScienceWatch, a web resource for science metrics and ... as among the most influential "are performing and publishing ... advancement of their science," according to a Thomson Reuters ...
(Date:8/21/2014)... Mller the Fram Strait is a key region in the ... between Greenland and Svalbard warm Atlantic water flows to the ... cold Arctic water masses and sea ice push their way ... portion of the Atlantic water cools here on its way ... of the water caused in this manner drives the global ...
Breaking Biology News(10 mins):LiveScan Provider Binary Biometrics Announces Partnership with Preeminent CNA School, Gabriel Health Institute to Expand Services in Orlando Region 2LiveScan Provider Binary Biometrics Announces Partnership with Preeminent CNA School, Gabriel Health Institute to Expand Services in Orlando Region 3BIDMC researchers named among 'the most influential scientific minds' 2BIDMC researchers named among 'the most influential scientific minds' 3Arctic sea ice influenced force of the Gulf Stream 2Arctic sea ice influenced force of the Gulf Stream 3
Other Tags
circuitrythinkingmapsdeficitdyingdesertcardiometabolicdipregrowparametersmanagesscriptshandfulavertperversitydrills