Tag: "loop" at biology news

Viral genetic differences are possible key to HIV dementia

...viduals," he asserts. Another mutation in the V3 loop appeared consistently in virus from study subjects who demonstrated the most severe cognitive impairment. This mutation was absent in sequences from subjects with little or no cognitive deficit. "In other words," says Pillai, "there appears to be a ...

Einstein researchers find 'key' to unlocking world's deadliest malaria parasite

... falciparum. So they fashioned a plasmid (circular loop of DNA) containing several elements: the gene for the Bronx Bomber enzyme; a section of DNA that would bind the plasmid to a complementary section of DNA inside P. falciparum; and a marker gene fused with a green fluorescent protein that would light ...

Novel connection found between biological clock and cancer

...tes expression of the period-4 gene. This closes a loop connecting the clock to period-4 and period-4 to the clock and the cell cycle. The clock normally modulates expression of this gene that encodes an important cell cycle regulator, and that cell cycle regulator in turn affects not only the cell cycle ...

Finding a cellular Neverland: How stem cells stay childlike

...ed cells." Identifying the Nanog/Smad1 feedback loop indeed has significant implications for regenerative medicine. Animals like salamanders readily regenerate severed limbs as adults, but mammals cannot. In fact, mammals have a limited repertoire of tissues they can regenerate, and some essential ones...

Coral death results from bacteria fed by algae

... We think this process sets up a positive feedback loop that accelerates the rate of decline in already damaged reef ecosystems." The report describes the other conditions that put coral reefs at risk. Overfishing reduces the number of fish that graze on algae, thus increasing the amount of algae on the ...

Genetic tug of war determines sexual differentiation

... the testis pathway. "In XX gonads, this Sox9-Fgf9 loop is not established, so Wnt4 takes over, tilting the balance toward the female pathway," Capel said. "Based on our findings, we believe that the ultimate fate of the early gonads is controlled by mutually antagonistic signals between Fgf9 and Wnt4." S...

News tips from The Journal of Neuroscience

...ning to identify compounds similar to NGF -hairpin loop 1. Four loop 1 mimic (LM11A) compounds had neurotrophic, prosurvival activity in cultured mouse hippocampal neuro...

Researchers look to nature for design inspiration

...n creates an electrical and mechanical information loop that provides researchers with a better idea of how the muscle reacts to certain mechanical stimuli. And in research that could lead to novel strategies for tissue engineering, repair and replacement, Georgia Tech biologist J. Todd Streelman is looki...

Unique dual target specificity of kinase inhibitor key for success against cancer

...rrently inhibited because of a regulatory feedback loop that renders a monospecific inhibitor ineffective. Importantly, dual inhibition of p110 and mTOR with a low dose of PI-103 elicited no drug-related toxicity and was highly effective against human gliomas transplanted into mice. "These data suggest t...

No-mow grass may be coming to your yard soon

...egulate their own expression as part of a feedback loop that, ultimately, determines the size of a plant. In nature, that feedback loop has served plants well, helping them adjust their height and size to fit the growing conditions of a...

Research provides clues to obesity's cause and hints of new approach for curbing appetite

... that appetite may be regulated through a feedback loop that includes the liver in addition to the brain and fat cells that secrete leptin. One of the many questions yet to be answered is whether too much fat increases CRP or if it's the high levels of CRP that make one fat. Dr. Zhao and his team are con...

Special issue of the Journal of Industrial Ecology focuses on eco-efficiency

...and investment, and the eco-efficiency of advanced loop closing (recycling) techniques in Japan....

Story tips from the Department of Energy's Oak Ridge National Laboratory

...ls, transmission and power electronics. A floating loop integrated cooling system for advanced vehicle app...sed in fuel cell and hybrid vehicles. The floating loop system eliminates the need for a separate piping system and heat exchanger, yet enables the air cond...

Anthrax spores may survive water treatment

...pes, by running contaminated water in a continuous loop through sections of pipe made of either copper, CPVC or galvanized iron (a material no longer used for home plumbing but existing in older construction). After 6 hours anywhere from 20 to 40 percent of spores had attached themselves to the surface o...

Duck-billed dino crests not linked to sense of smell

...crests, which contain elongated nasal passages and loop over their skull. Duck-billed dinosaurs are sometimes referred to as the "Cows of the Cretaceous period" and lived 85 million to 65 million years ago. Evans reconstructed the dinosaurs' brain cavity using well-preserved fragments of fossilized bone a...

Rockefeller researchers discover a biological clock within a clock

...uce proteins that fluctuate in a negative feedback loop that takes about 24 hours to complete. At night, two other genes (clock and cycle) stimulate production of Period and Timeless proteins, which begin to accumulate in the cell's cytoplasm. After about six hours, the two proteins move into the nucleus;...

Brain's own cannabis compound protects against inflammation

...a "gatekeeper" and an important "negative-feedback loop within the CNS [central nervous system] immune system needed to reduce the extent of the inflammatory response and to limit neurodegenerative immune reactions after primary brain damage. "Moreover, endocannabinoid signaling strongly suppresses attack...

Membrane research opens window to benefits for plants, humans

... residues, they found, latch onto an intracellular loop of the protein, blocking the water channel when no...quaporins, because sequencing has shown the gating loop to be conserved in them. "Plant cells close their water channels in response to drought stress in or...

Study in Royal Society journal on link between creativity and mating success

...uelich, JUELICH, 52425, GERMANY Multiple feedback loop design in the tryptophan regulatory network of Esc...study reveals that this specific multiple feedback loop design enables the bacterium to maintain rapid and stable production of tryptophan even in presence ...

New microscope allows scientists to track a functioning protein with atomic-level precision

...ching model, whereby RNAP pulls in ("scrunches") a loop of DNA, copies each base in the loop, then grabs another loop farther up the ladder. Determining which model is correct has been a difficult challenge, because...

1 2 3 4

(Date:5/21/2013)... battle? Try staying fit in space, where living quarters ... , That,s the challenge a group of Michigan State ... million grant from NASA. Their goal is to keep ... "You could give astronauts the best exercise regimen there ... to it, it isn,t going to help," said project ...
(Date:5/21/2013)... biomass experts , Where? Copenhagen, Denmark: ... 03-07 June 2013 , Why? ... market and policy developments, manufacturing and installation, drawing on ... from its 2013 edition from a record of more ... more than 240 plenary and oral presentations, more than ...
(Date:5/21/2013)... The epigenetic modifications, which alter the way genes ... apparently be detected in the blood of pregnant ... way to foretell depression in the weeks after ... symptoms become debilitating. , The findings of the ... online in the journal Molecular Psychiatry . ...
Breaking Biology News(10 mins):Fueling fitness on the final frontier 221st European Biomass Conference and Exhibition 221st European Biomass Conference and Exhibition 321st European Biomass Conference and Exhibition 4Genetic predictors of postpartum depression uncovered by Hopkins researchers 2Genetic predictors of postpartum depression uncovered by Hopkins researchers 3
Other Tags
deficitmammarymissilesguidedcoloradoinfluencesculturealoneopensdocumentedruinousmethamphtetamineflycheckfacedmetacognition