Tag: "meaty" at biology news

Gorilla diet tips -- Have we 'evolved to eat mush'?

...docile, cow-like creatures who favor leaves, while meaty foods are left to high-energy chimps. Fossey's gorillas, however, lived in a cold, wet, volcanic region of Africa and had little access to meat, Stanford explained. In more typical environments, he said, gorillas compete aggressively with chimps for ...

Toxins drove evolution of human taste sense, global study reveals

...itter, sweet, sour, salty and umami -- a savory or meaty taste. Taste receptors are protein switches that trigger signals to the brain's taste-processing centers in response to particular foods or other chemicals. In humans, 25 genes are responsible for encoding receptors that detect bitter flavors. The cu...

Taking 'chips' to the next level of gene hunting

... mutations in humans because they look only at the meaty parts of genes, but the human genome is only 3 percent meaty parts," says Jef Boeke, Ph.D., Sc.D, professor of molecular biology and genetics and director of the...

1

(Date:5/16/2013)... to Research Careers) Program has announced the travel ... Annual Meeting in San Francisco, CA from June ... the entry of students, postdoctorates and scientists from ... science community and to encourage the participation of ... , Awards are given to poster/platform presenters and ...
(Date:5/16/2013)... ancient shorelines to predict the stability of today,s largest ice ... from three million years ago, for example when Earth ... be evidence of a high sea level due to ice ... scientists to think that if the world,s largest ice sheets ... same in our modern, progressively warming world. , However, ...
(Date:5/16/2013)... cellular layer lining the body,s blood vessels, is ... in thickness, this super-tenuous structure routinely withstands blood ... create a unique and highly dynamic barrier that ... the body,s circulatory system. , It,s also extremely ... physically breached to enable immune cells to ...
Breaking Biology News(10 mins):World's biggest ice sheets likely more stable than previously believed 2Endothelium, heal thyself 2Endothelium, heal thyself 3Endothelium, heal thyself 4
Other Tags
manageradoptionhysteriagrapplingbrewsphysicistsmillipedescavemassesremovingcompletelyappropriatewiperelativelycursorsmalarial