Tag: "mouse" at biology news

Interaction of just 2 genes governs coloration patterns in mice

...D and Jesse Weber at Harvard studied Peromyscus, a mouse that is the most widespread mammal in North Americ...dividual hairs. When both genes are turned on, the mouse is dark in color. A mutation that changes either gene leads to a somewhat blonder mouse, but it is t...

Newly created cancer stem cells could aid breast cancer research

...hen Ince injected more than 100,000 of them into a mouse with a compromised immune system, it quickly devel...e cancer cells he created would metastasize if the mouse lived longer. He repeated the experiment in other mice, reducing the number of cells in the injectio...

Gene regulation, not just genes, is what sets humans apart

...elative to compare the regulatory sequences. The mouse genome had been used as a reference point for comparing the coding sequences of humans and chimps, but the non-coding sequences have generally evolved much faster. Mice wouldnt work for analyzing the non-coding sequences, because theyre too different...

High blood pressure, low energy -- a recipe for heart failure

...archers observed signs of early heart failure: the mouse hearts dilated and didn't contract effectively, the heart walls thinned, fibrous connective tissue accumulated and some heart cells died. They also saw that the hearts had depleted fuel reserves. Kelly indicates that these studies show for the first...

Abnormal fat metabolism underlies heart problems in diabetic patients

... 16-hour fast caused significant problems with the mouse hearts' ability to pump blood, again implicating altered lipid metabolism, cardiolipin scarcity and mitochondrial impairment in heart disease using lipid as predominant fuel. Gross adds that in addition to the effects on mitochondria, many of the mem...

OHSU turns mouse into factory for human liver cells

...versity researchers have figured out how to turn a mouse into a factory for human liver cells that can be u...uman liver cells into the mice was narrow, and the mouse liver, despite efforts to make the animal immunodeficient, often rejected the human cells. Grompe'...

Antioxidant overload may underlie a heritable human disease

...ral antioxidant known as glutathione. The mutant mouse hearts exhibited a heightened stress response, including higher activity of heat shock proteins that have been documented in human heart failure, Benjamin explained. Such stress responses yield reactive oxygen species, triggering antioxidative pathwa...

A unique arrangement for egg cell division

...ver time with a high resolution microscope in live mouse oocytes, Ellenberg and his PhD student Melina Schuh found that the missing centrosomes are replaced by a flexible system of many small microtubule organising centres (MTOCs) in oocytes. Like centrosomes, these MTOCs serve as platforms from which micr...

Cardio exercise benefits in male vs. female hearts

...y. They also isolated and analyzed the RNA of each mouse to look at any changes at the molecular level. Results The researchers found that the female mice: showed a much higher level of exercise performance (9.2 km/d vs. 6.4 km/d) had a greater increase in LV mass (15 percent vs. five percen...

Inflammation may cause preterm labor and fetal deaths

...the Journal of Immunology. New findings from the mouse study holds potential to develop ways to curb the ...ught about the fetal death in mice. In a prior mouse study at Case Western Reserve, the investigators noted that inflammation closely paralleled localiza...

Penn researchers discover how key protein stops inflammation

...rols inflammation by examining how Bcl-3-deficient mouse cells respond to infection. Their studies revealed that Bcl-3 interacts with p50, a protein that inhibits gene transcription by binding to DNA. p50 turns off the DNA region coding for inflammation, halting the response to infection, explains Chen. ...

Teamwork between 2 key proteins necessary for normal development and regulation of red blood cells

...ic globin genes responsible for the development of mouse embryonic red blood cells. EKLF plays a central...e expression and red blood cell development in the mouse embryo. They used mouse embryos missing both the KLF2 and EKLF genes to show that embryonic globin e...

Not all embryonic stem cell lines are created equal

...ers, she said. Before, it was only possible to use mouse or other animal cells to model neurodegenerative diseases, but the genetic background is so different from that of humans that key aspects of diseases such as Alzheimers could not be reproduced. Both Sun and Sdhof said that their findings have implic...

Disabling a sensory organ prompts female mice to act like male mice

...engages a neural circuit that determines whether a mouse shows its feminine side or acts like a male. Bio...t, plumbed the neural depths of sexually dimorphic mouse behavior by engineering females to have functionally deficient vomeronasal organs. Also known as Jac...

Defects in critical gene lead to accelerated lung tumor growth

.... 5 in the journal Nature, also presents the first mouse model of the most lethal malignancy in man, a form...not know what this gene does, Sharpless said. This mouse model will enable us to determine how this gene is important for lung cancer and to develop therapie...

A sensory organ, not the brain, differentiates male and female behavior in some mammals

...l circuit during development, or the mature female mouse brain may require vomeronasal activity to repress ...ecific behaviors develop and persist in the female mouse brain, but are repressed by the normal activity of the vomeronasal organ." "In fact, our research ...

Scientists prove that disputed Korean stem cell line comes from an unfertilized egg and not cloning

...h genome-wide analysis of five novel pES cells, 30 mouse ntES, as well as the SCNT-hES-1 cell line, the first human ES cell line purportedly generated by Korean scientists using human eggs and somatic cell nuclear transfer. The original paper describing the SCNT-hES-1 cell line was retracted after an inves...

Discredited Korean embryonic stem cells' true origins revealed

...s used sophisticated genetic techniques to compare mouse embryonic stem cells derived from different sources: from embryos produced by natural fertilization; from embryos produced by parthenogenesis (through artificial activation of unfertilized eggs); and from embryos created through somatic cell nuclear ...

Altering a protein makes mice less fearful

...ced a beaker containing a fox-odor chemical in the mouse enclosure. Normal mice froze when they smelled the... effect of disrupting the ion channel in mice, the mouse gene is very similar to the human gene, and the ASIC1a is present in human brains, where it is found...

COX-2 inhibitors delay pancreatic cancer precursors in mice

... high-grade PanINs (stage III) can be found in the mouse pancreas. According to Dr. Eibl, most researchers ... for 10 months; the other was offered only regular mouse chow. Their analyses revealed that the nimesulide diet greatly reduced the number of late-stage PanI...

1 2 3 4 5 6 7 8 9 10

(Date:5/21/2013)... battle? Try staying fit in space, where living quarters ... , That,s the challenge a group of Michigan State ... million grant from NASA. Their goal is to keep ... "You could give astronauts the best exercise regimen there ... to it, it isn,t going to help," said project ...
(Date:5/21/2013)... biomass experts , Where? Copenhagen, Denmark: ... 03-07 June 2013 , Why? ... market and policy developments, manufacturing and installation, drawing on ... from its 2013 edition from a record of more ... more than 240 plenary and oral presentations, more than ...
(Date:5/21/2013)... The epigenetic modifications, which alter the way genes ... apparently be detected in the blood of pregnant ... way to foretell depression in the weeks after ... symptoms become debilitating. , The findings of the ... online in the journal Molecular Psychiatry . ...
Breaking Biology News(10 mins):Fueling fitness on the final frontier 221st European Biomass Conference and Exhibition 221st European Biomass Conference and Exhibition 321st European Biomass Conference and Exhibition 4Genetic predictors of postpartum depression uncovered by Hopkins researchers 2Genetic predictors of postpartum depression uncovered by Hopkins researchers 3
Other Tags
deficitmammarymissilesguidedcoloradoinfluencesculturealoneopensdocumentedruinousmethamphtetamineflycheckfacedmetacognition