Tag: "obtain" at biology news

HYPER-CEST MRI breaks new ground in molecular imaging

...ecule that sits on the surfaces of cancer cells to obtain critical morphological information. Improving the biosensor construct, it may even be possible to eventually bring our sensitivity down to a single cell." For their Science paper, the Berkeley researchers demonstrated their HYPER-CEST technique on ...

NIEHS allocates $74 million to study environmental causes of disease

..., North Carolina, to allow potential applicants to obtain information and clarify any questions about the funding opportunities. Detailed information about the meeting, including time, location, and the new grant opportunities, is available at the Exposure Biology Program website: www.gei.nih.gov/exposureb...

Successful one year gene therapy trial for Parkinson's disease announced by Neurologix

...re. Because it may take years to develop, test and obtain regulatory approval for a gene-based therapy produ... unable to sustain profitability. In order to obtain the regulatory approvals necessary to commercialize its current or future product candidates, from t...

Few clues about African ancestry to be found in mitochondrial DNA

...nalyse individuals' mitochondrial DNA sequences to obtain information about their origins. The current study suggests that only one in nine African Americans may be able to find clues about where their ancestors came from, in their mitochondrial DNA. Bert Ely, from the University of North Carolina, and co...

Rising ocean temperatures, pollution have oysters in hot water

...emperatures and a common heavy metal are unable to obtain sufficient oxygen and convert it to cellular energ...han the unexposed group, but were either unable to obtain enough oxygen, convert the oxygen they obtained to energy, or both. The researchers drew this conclu...

New technique boosts size of proteins that can be analyzed

...d, heated and then bashed with gas molecules -- to obtain their pieces for the mass analysis. They are sprayed in an electric field where they pick up charges and are vaporized as they pass through a heated capillary. Then they are hit by air molecules in low-energy collisions to keep the protein from foldi...

Sequencing of the oyster mushroom genome

...n, animal, vegetable and microbian), enables us to obtain an overall and more enriched picture of the evolution of life on Earth. In the second year of the project, the reading of the genome will be completed and the annotation of the genes perfected. In the end, all the information will be placed at th...

Study links receptor to stress-induced alcohol relapse

... the amount of regular rats, and do so in order to obtain the intoxicating effects of alcohol. This behavior was extinguished, or unlearned, by a 15-day period during which bar-pressing yielded no alcohol, thus allowing the alcohol-preferring rats to achieve a state of sobriety. Investigators then assessed...

One-of-a-kind imaging probe reveals secrets useful for drug discovery

... make medicines. It also shows that scientists can obtain volumes of information from very tiny samples, whi... the component that is inserted into the magnet to obtain chemical information from the samples. Developed by scientists at the National High Magnetic Field ...

Scientists use gene signatures to match cancer and other diseases with potentially effective drugs

...nt drugs and other chemical compounds, was used to obtain information on treatments for obesity, Alzheimer's disease, and cancer, and to suggest new therapies for drug-resistant leukemia and advanced prostate cancer. Scott Armstrong, MD, PhD, a pediatric oncologist at Dana-Farber and Children's Hospital B...

Gene therapy study takes aim at prostate cancer

...al prostatectomy). To register for the study or to obtain further information, patients may call 713-798-4895....

Better sludge through metagenomics

...horus removal (EBPR). The researchers were able to obtain a nearly complete genetic blueprint for a key player in this process, the bacterial species Accumulibacter phosphatis. Activated sludge wastewater treatment processes are used throughout the world to purify trillions of gallons of sewage annually....

What animals can tell us about hemorrhage, organ transplants and aging

...rogram summaries. Members of the media who want to obtain a complete set of conference abstracts can contact Christine Guilfoy, cguilfoy@the-aps.org or at (301) 634-7253. ...

USGS at The Wildlife Society: From sea-ice change to contaminants to predators and prey

...remotely deployed satellite-linked transmitters to obtain locations and chronologies of the haul-out status of individual Pacific walruses (Odobenus rosmarus divergens) in sea ice of the Bering Sea during early spring of 2004, 2005 and 2006. These data were matched with weather data from NOAA's National Cen...

Mars mission Risk 29: Scientists research ways to reduce radiation-induced brain damage

...c analysis of portions of the irradiated brains to obtain more precise details about the biochemical changes. To date, many scientists have suggested that reduced cognitive impairment results solely from the death of the brain's neurons. Britten believes other, more complex mechanisms are at work, process...

No guts, no worries

... extracted directly from environmental samples--to obtain a profile of the microbial community residing in a particular environment. This is the first instance of such a symbiotic relationship being analyzed by using a metagenomic shotgun sequencing approach, heralding a renaissance in symbiosis research. ...

Researchers watch seeds in 3-D and discover an unknown air path

... quantitative phase tomography at beamline ID19 to obtain three-dimensional images of an arabidopsis seed. This seed is a model plant for biologists and the first one the genome was sequenced. "This approach is to our knowledge the only imaging technique with the penetration capacity and imaged field size ...

Researchers image molecular motor structural changes

... along microtubules. But they had not been able to obtain images of the actual structural changes kinesins undergo as they move along microtubules. In the first step toward this breakthrough, the researchers used an existing technology, electron microscopy, which normally enables scientists to magnify very...

Molecular markers signal early metastases from ocular melanoma

...dy in which cancer centers around the country will obtain fine needle aspirates from ocular melanoma patients and send them to Washington University for analysis. If this study confirms the usefulness of the procedure on a large scale, it could become routine practice. Patients at high risk for metastasis ...

Aussie team makes landmark insulin discovery

... Australian science." The immediate goal now is to obtain high resolution data on the insulin/insulin receptor complex and to extend this work to the closely related insulin-like growth factor (IGF) and the IGF receptor system, which is known to be important in cancer. Dr Ward says: "The challenge for the f...

1 2 3 4 5 6 7 8 9 10

(Date:8/21/2014)... , Aug. 21, 2014 /PRNewswire-iReach/ -- ... it has agreed to a partnership with Gabriel ... fastest growing Certified Nursing Assistant ... Health Institute  an exclusive member of Binary,s LiveScan ... Binary Biometrics will improve its service capabilities ...
(Date:8/21/2014)... Nine researchers from Beth Israel Deaconess Medical ... "The World,s Most Influential Scientific Minds 2014," ... Reuters ScienceWatch, a web resource for science metrics and ... as among the most influential "are performing and publishing ... advancement of their science," according to a Thomson Reuters ...
(Date:8/21/2014)... Mller the Fram Strait is a key region in the ... between Greenland and Svalbard warm Atlantic water flows to the ... cold Arctic water masses and sea ice push their way ... portion of the Atlantic water cools here on its way ... of the water caused in this manner drives the global ...
Breaking Biology News(10 mins):LiveScan Provider Binary Biometrics Announces Partnership with Preeminent CNA School, Gabriel Health Institute to Expand Services in Orlando Region 2LiveScan Provider Binary Biometrics Announces Partnership with Preeminent CNA School, Gabriel Health Institute to Expand Services in Orlando Region 3BIDMC researchers named among 'the most influential scientific minds' 2BIDMC researchers named among 'the most influential scientific minds' 3Arctic sea ice influenced force of the Gulf Stream 2Arctic sea ice influenced force of the Gulf Stream 3
Other Tags
circuitrythinkingmapsdeficitdyingdesertcardiometabolicdipregrowparametersmanagesscriptshandfulavertperversitydrills