Tag: "our" at biology news

Facial attraction -- choice of sexual partner shaped the human face

...d large eyebrows are sexy, at least in the eyes of our ancestors, researchers at the Natural History Muse...jor role in shaping human evolution, as studies on our fossil ancestors have shown our choice of sexual partner has shaped the human face. The findings app...

Study begins to reveal clues to the cause and progression of sepsis

...tion and treatment of cardiovascular disease. With our study, were hoping to do the same for sepsis, providing a greater understanding of the disease on which future treatment and prevention strategies can be based. For this analysis, researchers evaluated data from 1,886 of the study participants who ...

Saudi Arabia's KAUST names WHOI first research partner

...Sea oceanography and marine life. We treasure our relationship with Woods Hole not only because it is our first formal collaboration with another world-class research institution, said Nadhmi Al-Nasr, Int...

AFCYBER holds science and technology symposium

...ce. This was a great opportunity for us to share our knowledge and experience while forging a way ahead...e and technology. Improved technology will allow our Airmen, as Cyber warriors, to defend critical nodes inside and outside of the United States against ...

Beyond batteries: Storing power in a sheet of paper

...be addressed by nanomanufacturing technologies and our truly inter-disciplinary collaborative activity that brings together advances and expertise in nanotechnology, room-temperature ionic liquids, and energy storage devices in a creative way to devise novel battery and supercapacitor devices," Nalamasu ...

Diverse genetic abnormalities lead to NF-κB activation in multiple myeloma

...hat the acquisition of the mutations identified in our study results in the accumulation of malignant plasma cells beyond the physiological control of the bone marrow compartment. Our results suggest a mechanism by which MM cells can overcome these limitations through acquisition of mutations that result...

Bursts of waves drive immune system 'soldiers' toward invaders

...n might be organizing cell movement - an idea that our subsequent experiments validated. "We never expe...ious way to organize cell movement. We're getting our first glimpses that take us beyond knowing that this protein is important for cell motility to learn...

Protein 'chatter' linked to cancer activation

...logy and the lead author on the study. As we age, our chromosome ends become shorter. Individuals whose ...some ends are a serious threat to the stability of our genome. When the genome becomes unstable, it puts our bodies at greater risk of cancer. Zhu adds ...

Newly created cancer stem cells could aid breast cancer research

... breast tumors, cancer cells resemble those lining our bodys cavities. A trained pathologist can spot the similarities under a microscope. But the cancer cells previously engineered from normal breast cells for laboratory studies looked different. Ince suspected that researchers were transforming the wro...

Doernbecher Children's Hospital scientist earns coveted Javits award

...r. "Dr. Back's groundbreaking work is increasing our knowledge of whatcauses cerebral palsy and other i... movement and intellect," Back explained."However, our recent studies suggest that this view may not becorrect." Back and Lawrence Sherman, Ph.D., an ass...

MIT creates 3-D images of living cell

...ccomplishing this has been my dream, and a goal of our laboratory, for several years, said Feld, senior author of the paper. For the first time the functional activities of living cells can be studied in their native state. Using the new technique, his team has created three-dimensional images of cervi...

New textbook illuminates the close links between evolutionary and molecular biology

...ral habitats. Evolutionary biology underpins all our knowledge of the living world, write the authors. [It] is a synthesis of Darwinian natural selection and Mendelian genetics. It allows us to ask not just how life evolved, but why it is as it is: Why do organisms develop from a single cell? Why i...

ESF EURYI award winner aims to stop cancer cells reading their own DNA

...e the information stored within the DNA and RNA of our cells. Dekker is exploiting a variety of new highly sensitive manipulation and imaging techniques capable of resolving single molecules. These include force spectroscopy, new forms of optical microscopy with greatly improved resolving power and field...

No evidence that widely prescribed statins protect against prostate cancer

...Research. The public health significance is that our study provides evidence that statins may not have a clinically meaningful impact on testosterone in the blood, although further studies should be done, said study author, Susan A. Hall, Ph.D., a research scientist at the New England Research Institut...

Tropical insects 'go the distance' to inform rainforest conservation

...of the report. They also play an important role in our global climate and provide aesthetic, recreational and medicinal benefits. For these reasons and others, it is critical that we understand how these forests generate and sustain their diversity and what we can do to help conserve them. The study i...

Genetic variation helps to understand predisposition to schizophrenia

...dont directly disturb the function of proteins. In our study, we identified some clues as to what goes wrong with one of these DNA variations. The study was selected as a Paper of the Week by the journals editors, meaning that it belongs to the top one percent of papers reviewed in significance and o...

Gilbert Foundation and American Fed for Aging Research award grants on Alzheimer's disease

...as made an investment in research that will add to our knowledge about the aging brain and how the interplay of genes, environment and chance events influence neurodegeneration, particularly Alzheimers disease, said George M. Martin, MD, Director Emeritus, Alzheimers Disease Research Center, University o...

1 of deep ocean's most turbulent areas has big impact on climate

..., he said. The mixing we observed and measured for our study allows the warmth at the surface of the ocean to diffuse deep into the sea. The overall balance between warm and cold water in the Atlantic helps control the strength of the Gulf Stream, which moves heat away from the Earths equator toward regi...

A study by the MUHC and McGill University opens a new door to understanding cancer

...tion about ubiquitin marks an important advance in our understanding of the mechanisms associated with cancer and contributes to the fight against the disease by directing us towards research avenues for new medications. ...

Research shows skeleton to be endocrine organ

... skeleton is an endocrine organ that helps control our sugar metabolism and weight and, as such, is a maj...treatment of type 2 diabetes. The discovery that our bones are responsible for regulating blood sugar in ways that were not known before completely chang...

1 2 3 4 5 6 7 8 9 10

(Date:5/17/2013)... Shenzhen, China---- Why Tibetan antelope can live at ... a collaborative research published in Nature Communications ... institutes provide evidence that some genetic factors may ... highland environments. The data in this work will ... and the biology of other ruminant species. , ...
(Date:5/17/2013)... team of scientists using a new X-ray method recorded ... frog embryo in greater detail than ever before., This ... and the search for new treatments for genetic diseases., ... Technologie in Germany, in collaboration with the Advanced Photon ... Laboratory, released the most precise depiction ever of the ...
(Date:5/16/2013)... fast food restaurant had a higher body mass index ... food, according to researchers at The University of Texas ... strong among those with a lower income. , ... Journal of Public Health indicates higher BMI associates ... among lower-income African-Americans, the density, or number, of fast ...
Breaking Biology News(10 mins):The genome sequence of Tibetan antelope sheds new light on high-altitude adaptation 2New X-ray method shows how frog embryos could help thwart disease 2Body mass index of low income African-Americans linked to proximity of fast food restaurants 2Body mass index of low income African-Americans linked to proximity of fast food restaurants 3
Other Tags
naturetoldentrepreneursrepellentsfiringmixesriboswitchespeekscryingnighttimechronicinfantsmaasiowacabonathan