Tag: "peripheral" at biology news

Stanford researchers establish center for physics-based simulations of biological structures

...has important implications for coronary artery and peripheral vascular disease (Chris Zarins). Addressing these problems "makes sure we make contributions soon to the science," Altman said. "We have scientists in those domains who've signed up to be early users of our software and to give us feedback as to whe...

Most promising clinical uses for stem cells from fat agreed on by international society

...ply, and for treating acute or chronic cardiac and peripheral vascular diseases. Moreover, the group felt the best use of the technology should be to develop therapies using patients' own cells, as opposed to cells that might be donated by other individuals. Because adipose is both abundantly available and ...

Muscle-building hand-grips aid systolic blood pressure, carotid AD, endothelial function

...g exercise on RBP as well as central (carotid) and peripheral (arm and leg arteries) AD in persons who were alre...ficantly. IHG didn't affect either diastolic BP or peripheral AD. The study also tested isometric leg press exercise, but it had no effect on any of the parameter...

Gene therapy approach reverses diabetic neuropathy in animal model, Pitt study finds

...h generally affects the sensory neurons within the peripheral nervous system and is characterized by such sympto... gene therapy had complete reversal of established peripheral neuropathy and restoration of lost nerve endings to their feet, reported James R. Goss, Ph.D., resea...

Warning from new SLU research: Usual test for vitamin deficiency can mislead doctors

... "B12 deficiency is associated with dementia, peripheral neuropathy and spinal cord disease," says Florian ...stating neurological damage to the spinal cord and peripheral nerves. The link to nitrous oxide was recognized and the patient recovered with B12 replacement. ...

Sick kids researchers unmask the potential of stem cells found in adult skin

...nature. These neural crest stem cells generate the peripheral nervous system, and we are therefore now confident...uring embryogenesis. In addition to generating the peripheral nervous system, neural crest stem cells generate other tissues such as bone, cartilage, some types o...

JCI table of contents November 1, 2004

...adiposity, higher energy expenditure, and improved peripheral insulin action AUTHOR CONTACT: David E. James Garvan Institute of Medical Research, 384 Victoria St, Darlinghurst, NSW 2010, Australia Phone: 61-2-9295-8210; Fax: 61-2-9295-8201; E-mail: d.james@garvan.org.au View the PDF of this article at: https...

Elevated inflammatory enzyme, Lp-PLA2, significantly linked to ischemic stroke

...the underlying cause of heart attacks, strokes and peripheral vascular disease, accounts for 50 percent of all deaths in Western countries. Atherosclerosis involves inflammation within the walls of blood vessels, which likely begins in the presence of LDL-C and then involves certain white blood cells and the f...

No getting around RET

... which are important in developmental milieux from peripheral neurogenesis to the developing kidney, remains a thorny question complicated by the fact that GFR is much more widely expressed in the body than is RET and that, in vitro, cells expressing GFR1 without RET have been shown to respond to GDNF signals. ...

Peripheral timekeeping: Mammalian cells outside the brain have their own circadian clocks

...es emitted light with a circadian rhythm. However, peripheral tissue rhythms tended diminish after a few cycles in culture, suggesting that they might depend on the central nervous system's SCN to drive them. In the new work, performed by researchers at The Scripps Research Institute and Northwestern Univers...

Psychological stress and disease: UCSF-led study suggests connection

...xidative stress -- in immune system cells known as peripheral blood mononucleocytes, in healthy premenopausal women. Telomeres are DNA-protein complexes that cap the ends of chromosomes and promote genetic stability. Each time a cell divides, a portion of telomeric DNA dwindles away, and after many rounds of ce...

Novel AT2R gene transfer prevents hypertension-related enlarged heart, cardiac fibrosis

...is of the heart, the perivascular fibrosis (around peripheral blood vessels) was not reduced, nor was blood pressure. On a clinical level this may seem a negative result, but Raizada noted that "we were targeting the gene to only affect the heart, so not influencing blood pressure is a good thing. Even better, ...

JCI table of contents, December 1 2004

...which the body's immune system attacks part of the peripheral nervous system (an autoimmune response) causing we... deficiency increases hepatic lipid production and peripheral lipid utilization AUTHOR CONTACT: Barbara B. Kahn Beth Israel Deaconess Medical Center Boston, Massa...

Stanford study links obesity to hormonal changes from lack of sleep

...d. "To my knowledge, this is the first time that a peripheral marker in the blood is shown to correlate with habitual sleep amounts in a general, normally behaving population." The researchers also found that in people sleeping less than eight hours (74.4 percent of the sample), increased BMI was proporti...

Neural crest stem cells in skin could provide alternative to embryonic stem cell use

...sease, multiple sclerosis, Hirschsprung's disease, peripheral neuropathies, certain defects of the heart, and bone degeneration. Though promising, this research is still in the animal testing stage. Additional research is required before it could benefit patients. ...

Genetic defect confers risk of major depression, resistance to SSRI drug therapy

... the earlier discovered TPH1 is found primarily in peripheral nerves. Caron's team reported earlier this year that different variants of that enzyme have a major effect on brain levels of serotonin in mice, suggesting that the human variant of the gene might underlie psychiatric disorders characterized by low ...

Cigarette smoking exacerbates alcohol-induced brain damage

...cigarette smoking on the heart, lungs, central and peripheral vascular systems, and its carcinogenic properties have been studied for many years in humans, very little is known about its effects on the brain and its functions," said Timothy C. Durazzo, a neuropsychologist and neuroscience researcher at the San ...

Femtosecond laser technique opens new opportunities for research on neural regeneration

...the equipment was set up. Although regeneration of peripheral nerves is nothing new, Chisholm said he was still ...and spinal cord--is usually permanent. "In humans, peripheral nerves will regrow, but in the central nervous system the regrowth of axons is inhibited by the loca...

JCI table of contents, December 15 2004

...and its ligand, AGE, are increased at the sites of peripheral nerves in diabetic patients. AGE was shown to induce increased and sustained activation of NF-kappaB, which is closely associated with nerve dysfunction, and this could be partially reversed by blockade of the RAGE receptor. Furthermore, the author...

Potent anticancer drug increases function of axons in mouse model of neurodegeneration

...dementia, parkinsonism or weakened motor skills in peripheral muscles, and later muscle atrophy. The protein tau, like Paxceed (or other natural products such as taxanes and discodermolides), is required to stabilize the microtubule. "Think of tau as the cross-tie of the microtubule train track," says Trojanow...

1 2 3 4 5 6 7 8 9 10

(Date:4/18/2014)... wildlife while feeding a world population predicted to ... holistic approach to conservation that considers human-altered landscapes ... Wildlife and the natural habitat that supports it ... world where at least three-quarters of the land ... rest is vulnerable to human-caused impacts such as ...
(Date:4/18/2014)... Seeds that sprout as soon as they,re planted may ... to be more careful. In the wild, a plant whose ... would risk disaster. More than just an insurance policy against ... seed dormancy has long-term advantages too: Plants whose seeds ... to more species, finds in a team of researchers working ...
(Date:4/17/2014)... COLUMBIA, Mo. April 17 In the most densely ... States, forests reflect two centuries of human needs, values ... logging and clearing forests for agriculture and development, have ... today, a U.S. Forest Service study reports. , The ... forest conditions and management needs in the Northern United ...
Breaking Biology News(10 mins):Stanford researchers rethink 'natural' habitat for wildlife 2Stanford researchers rethink 'natural' habitat for wildlife 3Stanford researchers rethink 'natural' habitat for wildlife 4Plants with dormant seeds give rise to more species 2Five anthropogenic factors that will radically alter northern forests in 50 years 2Five anthropogenic factors that will radically alter northern forests in 50 years 3
Other Tags
greatlyrumorsintegrityoctopussecretsbacteriumanthraxpotentialscreendefencesevadeshieldlovedincapacitatedwishespacemaker