Tag: "phospholipid" at biology news

Heart responds to fasting by remodeling vital energy-producing components

... in heart muscle cells and account for most of the phospholipid content of the cells. Mitochondria serve to break ...namically altering their use of phospholipids." A phospholipid decrease of the magnitude reported is all the more surprising because phospholipids comprise essenti...

Topic of ASBMB-Avanti Award Lecture will be lipid-protein interactions

...nd Saccharomyces cerevisia in which the membrane phospholipid content can be regulated in a systematic manner. His lecture will focus on how he is using these strains as biological reagents to determine the involvement of lipids in cellular functions. By combining molecular, genetic and biochemical approaches, ...

Self-assembled nano-sized probes allow Penn researchers to see tumors through flesh and skin

...membranes are created from a double layer of fatty phospholipid chains, a polymersome is comprised of two layers of synthetic co-polymers. Like a living cell, the polymersome membrane has a hydrophobic core. The study shows that the fluorophores evenly disperse within this core, giving rise to a nanometer-sized...

Liposome finding implies electrical effect on cell development

... "water balloons" composed of artificially created phospholipid bilayers similar to natural cell membranes have r...e observed to immediately form and extend from the phospholipid balloon, like a seed putting forth a stalk or root. Hayes believes that the phenomena may have signi...

Macromolecules on surface control mobility in phospholipid bilayers

...first supported a bilayer made of a single type of phospholipid molecule on a planar substrate (separated from the substrate by a thin layer of water several nanometers thick, the lipid molecules were free to move around). This simple bilayer mimicked the much more complex structure of a real cell membrane compri...

Beyond genes: Lipid helps cell wall protein fold into proper shape

...acterium E. coli, is affected by the presence of a phospholipid named phosphatidylethanolamine, or PE for short. Phospholipids, unlike their fatty acid and cholesterol cousins, include a phosphate group that spurs them to form a bilayer with water-friendly outer layers sandwiching an impermeable water-unfriendly...

Bugs expose underground carbon traffic system 10 times more important than fossil fuel burning

...cores with and without Collembola for a particular phospholipid fatty acid (PLFA) that is characteristic for AM mycelia. They found that this particular PLFA contained significant amounts of 13C in cores not exposed to Collembola. However those soil cores that were exposed to collembola which fed on the mycorrhiz...

Imbalance may trigger advance from fatty liver to liver failure

...dence in mice that a disproportionate ratio of two phospholipid constituents of cell membranes undermines membrane...guide these patients. "We had not conceived that a phospholipid ratio imbalance would have such an effect," he continued. "The major importance of the findings has ...

1

(Date:8/28/2014)... N.C. -- Scientists have identified the developmental on-off switch ... that produce more than two-thirds of the world,s naturally ... be to see whether it is possible to manipulate ... , The study, appearing August 28 in ... small molecule called cyclic-di-GMP and a larger protein called ...
(Date:8/28/2014)... examples of complex systems. Their infrastructure equipment requires ... cooling, transport to supply fuel, and ICT systems ... network chain is interconnected with a wider network ... of UK-based scientists has studied various aspects of ... been published in EPJ B by Gaihua Fu ...
(Date:8/28/2014)... Cars, planes and ... sophisticated assembly lines. Mobile assembly carriers, on to which the ... lines. In the case of a car body, the assembly ... precise spatial and chronological sequence, resulting in a complete vehicle ... such an assembly line at molecular level has been a ...
Breaking Biology News(10 mins):Small molecule acts as on-off switch for nature's antibiotic factory 2Small molecule acts as on-off switch for nature's antibiotic factory 3Inter-dependent networks stress test 2Nanoscale assembly line 2Nanoscale assembly line 3
Other Tags
speedycootsovulationperimenopausalpeeksgenesystemsstrepasidewallsbumpdegradationimmunitiesbrandedpolymerpurduesexes