Tag: "potent" at biology news

JCI table of contents, February 23, 2006

...erent cell types. Together these studies support a potent role of VLA-4 in the regulation of bone marrowderived progenitor cells in wound repair and migration. The authors suggest that inhibiting this homing process could be useful in suppressing new blood vessel formation in tumors. TITLE: A homing mechani...

New study shows antibody-interleukin complexes stimulate immune responses

...ows why these antibody-cytokine complexes are such potent immune response boosters in vivo. "A few studies have suggested that injecting a cytokine together with the right antibodyincreases the half-life of the cytokine in vivo, accompanied by a very mild immune activation," he said. "But our study suggests...

News tips from the Journal of Neuroscience

...rtment. Other MAGUKs, PSD-95 and SAP102, were less potent in these assays. 3. Male Behaviors and SexChromosome Genes Jessica D. Gatewood, Aileen Wills,Savera Shetty, Jun Xu, Arthur P.Arnold, Paul S. Burgoyne, andEmilie F. Rissman It's easy to blame testosterone for "male" behaviors such as aggression. But...

Experimental TB drug effective against resistant and latent mycobacterium tuberculosis

... company working to bring the drug to market. The potent killing activity of FAS20013 is directed specifically against slow growing mycobacteria that cause the disease rather than at a broad array of non-pathogenic organisms, which merely enhances the emergence of drug- resistant strains. No resistance has...

New compound may protect against liver cancer

...se in humans. "If this compound can produce such a potent and dramatic reduction in the number of pre-cancerous growths, it should have an equally dramatic impact on the development of actual cancers," he said. In addition to serving as a valuable tool in the development of new cancer prevention interventio...

JCI table of contents, February 9, 2006

...ot inhibited by the diabetes drug glibenclamide, a potent inhibitor of normal ROMK in kidney cells. The ROMK channels from Cftr-deficient mice also demonstrated an impaired response to a small energy molecule called ATP (adenosine triphosphate). These data suggest that the CFTR protein is a critical compone...

Scientists re-engineer a well-known antibiotic to counter drug resistance

... increase in binding ability-roughly 40 times more potent than today's version of the drug. The actual re-en...spur further research into the development of more potent antibiotics."...

Scientists force viruses to evolve as better delivery vehicles for gene therapy

... the viruses three times through increasingly more potent serum, they isolated the survivors and subjected them to another round of PCR that introduced more mutations. After passing this second generation through serum three times, they isolated viruses that could survive AAV antibodies much better than the...

JCI table of contents, February 1, 2006

...fasted dogs inhibits HGP. This inhibition was more potent than insulin infusion into the brain, where an important region known as the hypothalamus regulates metabolism. The study may provide new insights for type 2 diabetes, in which the elevated levels of liver gluconeogenesis result from the failure of t...

Researchers show the 'BEST' way to reduce osteoporosis risk

...he good news is these long-term data confirmed the potent combination of improved nutrition and increased physical activity to prevent bone loss. The extended use of calcium supplementation and exercise counteracted the typical loss of BMD in women at this age, in a regimen that women really can stick with,...

Virginia Tech researcher examining malignant melanoma in horses

...ies. Scientists have demonstrated that the oil has potent anti-inflammatory effects and anti-tumor properties when evaluated in tissue culture with tumors such as astrocytomas, melanomas, and fibrosarcomas. Furthermore, he said, it appears to have fairly selective anti-tumor activity and does not appear to...

British blackcurrants beat Alzheimer's

...land, shows that compounds in blackcurrants have a potent protective effect in cultured neuronal cells again...ch other.' Dilip's team recently demonstrated the potent protective effect of blackcurrant compounds on cultured human promyeloyte and neuroblastoma cells as...

Protein 'nanosprings' most resilient found in nature

... the living cell. The discovery also could provide potent nanoscale "shock absorbers" or "gate-opening springs" in tiny nanomachines. The team's findings were published in an advanced online publication of Nature on Jan. 15, 2006. The finding that the protein components, called "ankyrin repeats," exhibit ...

Gene-specific Ebola therapies protect non-human primates from lethal disease

...king critical viral genetic sequences, may be more potent than anti-virals such as protease inhibitors, which seek to inhibit a protein needed for viral replication. Ebola virus causes hemorrhagic fever with case fatality rates as high as 80 percent in humans. The virus, which is infectious by aerosol (alt...

Viral 'fitness' explains different resistance patterns to aids drugs

...oth NNRTIs and non-boosted protease inhibitors are potent antiretroviral drugs (ARVs) with demonstrated effe...-boosted or boosted with a small amount of another potent PI) and two different antiretrovirals from the nucleoside reverse transcriptase inhibitor class....

VCU researchers find risk factors for depression may be largely the same in men and women

...ldhood parental loss and low self-esteem were more potent variables in men than in women....

Tomato juice keeps emphysema from developing in new model; Lycopene cited

... prevented by concomitant ingestion of lycopene (a potent antioxidant) given as tomato juice" in SAMP1 mice. They added: "Smoke exposure increased apoptosis and active caspase-3 of airway and alveolar septal cells and reduced VEGF in lung tissues, but tomato juice ingestion significantly reduced apoptosis a...

Immune substances may help antibody-based drugs fight cancer

...e NK cells to release substances that attract more potent immune cells mainly killer T cells thereby trigging a larger and more effective immune response against the tumor. "Trastuzumab was not designed to mimic an infectious condition, but we think that's exactly what is happening," Roda says. Carson, ...

Soy diet worsens heart disease in mice, says University of Colorado at Boulder study

...and said plant estrogens have been shown to have a potent effect on living organisms. While they are sometimes suggested by doctors to treat menopausal symptoms in women, studies have shown that common plant estrogens like genistein and daidzein can contribute to reduced fertility in farm animals. "There...

Females, alcohol and hormones

...ales. People generally think that alcohol is more potent in females, but that is because women are smaller ... and emphasizes that in some ways, alcohol is less potent in females than in males. We propose that hormonal fluctuations or substances affected by those ho...

1 2 3 4 5 6 7 8 9 10

(Date:5/21/2013)... battle? Try staying fit in space, where living quarters ... , That,s the challenge a group of Michigan State ... million grant from NASA. Their goal is to keep ... "You could give astronauts the best exercise regimen there ... to it, it isn,t going to help," said project ...
(Date:5/21/2013)... biomass experts , Where? Copenhagen, Denmark: ... 03-07 June 2013 , Why? ... market and policy developments, manufacturing and installation, drawing on ... from its 2013 edition from a record of more ... more than 240 plenary and oral presentations, more than ...
(Date:5/21/2013)... The epigenetic modifications, which alter the way genes ... apparently be detected in the blood of pregnant ... way to foretell depression in the weeks after ... symptoms become debilitating. , The findings of the ... online in the journal Molecular Psychiatry . ...
Breaking Biology News(10 mins):Fueling fitness on the final frontier 221st European Biomass Conference and Exhibition 221st European Biomass Conference and Exhibition 321st European Biomass Conference and Exhibition 4Genetic predictors of postpartum depression uncovered by Hopkins researchers 2Genetic predictors of postpartum depression uncovered by Hopkins researchers 3
Other Tags
deficitmammarymissilesguidedcoloradoinfluencesculturealoneopensdocumentedruinousmethamphtetamineflycheckfacedmetacognition