Tag: "produced" at biology news

Discredited Korean embryonic stem cells' true origins revealed

...cells derived from different sources: from embryos produced by natural fertilization; from embryos produced by parthenogenesis (through artificial activation of unfertilized eggs); and from embryos created th...

Where broken DNA is repaired

...ound in cosmic rays, such as energetic iron nuclei produced in accelerators at Brookhaven National Laboratory. The goal is to determine how many double-strand breaks (DSBs) in which both strands of the DNA double helix are severed occur per gray of radiation. (One gray is equivalent to 100 rads, an older un...

Success or failure of antidepressant citalopram predicted by gene variation

...oduced, strengthening their validity. The protein produced by HTR2A acts as a receptor on brain cells for the chemical messenger serotonin, one of several neurotransmitters that enable the cells to communicate with each other. The discovery that a variation in a serotonin-related gene could affect response t...

Phase II study of therapeutic vaccine shows efficacy in patients with metastatic colorectal cancer

... protein is rarely found in normal tissues, but is produced at high levels by a wide range of human cancers, including colorectal, renal, gastric and ovarian. The production of 5T4 has been associated with cancer metastasis and poor prognosis for patients. Typically, the immune system doesnt pay attention ...

Handicapping tuberculosis may be the way to a better vaccine

...investigator William R. Jacobs and colleagues have produced a genetically altered strain of tuberculosis (TB) that elicits a stronger immune response than the current vaccine, bacillus Calmette-Gurin (BCG). The new vaccine improves survival of infected animals and may help put scientists on track to replace B...

New grants bolster efforts to generate faster and cheaper tools for DNA sequencing

... The resulting data could be linked to information produced by other emerging sequencing platforms....

Measuring nectar from eucalypts

...here has been no information on how much nectar is produced by retained trees or young trees regrowing after l...history nor tree size. When the amount of nectar produced by whole forest stands is estimated on the basis of individual flower measurements and counts of flo...

Under magnetic force, nanoparticles may deliver gene therapy

...d from the particle, entered the cell nucleus, and produced enough adiponectin to significantly reduce the proliferation of new cells. In a practical application, such nanoparticles could be magnetically directed into stents, the tiny, expandable metal scaffolds inserted into a patients partially blocked ve...

Chickens dieting to help Delaware waterways

...o put it in perspective, in 2006, Delaware farmers produced over 269 million broiler chickens--1.8 billion pou...g to the Delmarva Poultry Industry. Those chickens produced more than 280,000 tons of waste. According to recent analyses by David Hansen, UD assistant profes...

Cell damage caused by brushing may help keep gums healthy

...e area of interest is to identify chemical signals produced by wounded oral cavity cells that could promote gum health. Moreover, the method and/or type of brush might strongly influence the extent of epithelial cell-wounding and subsequent liberation of factors that promote gum health, Dr. McNeil says. In...

New aerogels could clean contaminated water, purify hydrogen for fuel cells

...e and behavior of the gels. The high-energy X-rays produced by the APS, however, allowed the scientists to take accurate readings of the atomic distances within these disorganized materials. "This is where the APS really excels. It's the only place that has a dedicated facility for doing these kinds of measur...

Insulin grown in plants relieves diabetes in mice; UCF study holds promise for humans

Capsules of insulin produced in genetically modified lettuce could hold the key...co to produce the insulin because that crop can be produced cheaply and avoids the negative stigma associated with tobacco. The National Institutes of Health ...

Wider buffers are better

...specially critical in controlling amounts of human produced nitrogen. Scientists at the U.S. Environmental Protection Agency collected data on the buffers along with nitrogen concentration in streams and groundwater to identify trends between nitrogen removal and buffer width, water flow path and vegetation...

Instant steam takes on MRSA

...f seconds, at room temperature and pressure. Steam produced by the technology is so-called dry steam, generated by the highly exothermic reaction between methanol and hydrogen peroxide. While too expensive to replace the vast quantities of steam used routinely by industry, a reaction chamber the size of a sug...

Using stem cells to help heart attack victims

...numbers of stem cell-derived cardiomyocytes can be produced for detailed analysis and they plan to use new 'electrophysiology' systems to record changes in the cells when cultured. Electrophysiology is the study of cells' electrical properties and this is the first time that the method has been used in the UK...

System to analyze beating heart stem cells could lead to heart attack treatments

...numbers of stem cell-derived cardiomyocytes can be produced for detailed analysis and they plan to use new electrophysiology systems to record changes in the cells when cultured. Electrophysiology is the study of cells electrical properties and this is the first time that the method has been used in the UK to...

More fish oil, less vegetable oil, better for your health

...ation of chemicals called prostanoids, which, when produced in excess, increase inflammation in various tissue...the body naturally regulates levels of prostanoids produced by fish and vegetable oil. If both oil types are present in the body, levels of prostanoids from fis...

Learning a second language -- Is it all in your head?

..., vece, nuck and fute). The sounds were originally produced by a speaker of American English and then re-synthesized at three different pitch tones, resulting in 18 different pseudo words. The participants were repeatedly shown the 18 pseudo words and a black and white picture representing each words meaning....

Call for EU to launch major project to map out all our proteins

...ld of proteomics aims to discover all the proteins produced by a given organism. Such a proteome map would bring the possibility of deducing the precise number, and location in the genome, of the genes coding for proteins. This is much more complex than simply mapping the genome from end to end because it inv...

Secondary waste from chemical weapons stockpile disposal

...that millions of pounds of secondary waste will be produced before the stockpiles are fully destroyed; effective management of the waste will be critical for the timely closing of the disposal facilities. The report examines the requirements for management of these wastes, including the appropriateness of off...

1 2 3 4 5 6 7 8 9 10

(Date:6/17/2013)... 2013 An international team led by scientists at ... Institute and Albert Einstein College of Medicine of Yeshiva ... that attacks the tuberculosis (TB) bacterium in two different ... solve one of the major global health crises of ... strains," said Peter G. Schultz, the Scripps Family Chair ...
(Date:6/17/2013)... ST. LOUIS -- In research published in Biochemical ... describe a technology that can detect new, previously unknown ... for viruses even when doctors have not identified a ... , In the new approach, scientists use ... discover viruses. , Taking advantage of the complete deciphering ...
(Date:6/17/2013)... early onset of puberty in girls, a new clinical ... Endocrine Society,s 95th Annual Meeting in San Francisco. , ... 10 and 14. Boys undergo these changes later, usually ... is diagnosed in girls when sexual development begins before ... when these changes occur before age 9. , Recently, ...
Breaking Biology News(10 mins):New compound excels at killing persistent and drug-resistant tuberculosis 2New compound excels at killing persistent and drug-resistant tuberculosis 3New compound excels at killing persistent and drug-resistant tuberculosis 4Saint Louis University researchers discover a way to detect new viruses 2Saint Louis University researchers discover a way to detect new viruses 3Vitamin D supplementation may delay precocious puberty in girls 2
Other Tags
capillarymaterialisemisshapentacticsoupamchitkapassivelawnsstaraffirmsmelodyunbornregretbeverageassurefao