Tag: "related" at biology news

Fever after smallpox vaccination tied to individual genetic variations

...rst time develop a fever over 99 degrees. Fevers related to vaccines are not considered a serious medical issue, but in rare cases they can lead to more severe complications. Individuals who get a fever after the smallpox vaccine occasionally develop myopericarditis, a potentially life-threatening inflamma...

Potent possibilities for parasite attack

.... "Identifying factors that allow three closely related organisms to cause vastly different clinical outco... causes malaria, about 20% of genes differ between related species. "Clearly there must have been considerable evolutionary pressure over time to maintain th...

Ancient Etruscans were immigrants from Anatolia, or what is now Turkey

...ividuals from Murlo and Volterra were more closely related those from near Eastern people than those of the o...ing in the former Etruria found that they too were related to breeds currently living in the near East. The history of the Etruscans extends before the Iro...

Muscle weakness: New mutation identified

...egulatory protein tropomyosin mutation is directly related to a mechanism by which the mutant tropomyosin modulates contractile speed and force-generation capacity. Dr. Julien Ochala and co-workers at the Department of Clinical Neurophysiology, University of Uppsala, in collaboration with scientists at the...

Staphylococcus aureus hides out in cells

... cured. S. aureus intracellular survival appears related to its capability to adopt a discrete behaviour instead of actively duplicating, says Patrice Francois, a Geneva-based member of the research team. S. aureus then benefits from natural or programmed cell death to re-emerge and trigger another episode...

Interim analysis of anti-cancer vaccine, BiovaxID, to be conducted

...l Trial, there are no identifiable safety concerns related to this therapy. The company believes that BiovaxIDs strong safety record will be supportive of its planned application for accelerated conditional approval of BiovaxID. BiovaxID is an anti-cancer vaccine that is in pivotal Phase 3 Clinical Trial f...

Small, self-controlled planes combine plant pathology and engineering

...ech research center that facilitates collaboration related to autonomous systems in the College of Engineering, the College of Agriculture and Life Sciences, and the College of Natural Resources. Scientists have used aircraft to monitor the movement of airborne pathogens for years, but Schmale is the first...

Study suggests other causes for childhood brain aneurysms

... age groups appeared to occur spontaneouslywith no related trauma or infection, recognizable clinical warnings signs or underlying medical causes, such as vascular malformations. Researchers say this data suggests unknown genetic factors, environmental exposures or an interaction of the two may predispose ...

ENCODE map changes view of the human genome landscape

...be located in non-coding regions may ultimately be related to disease. Contact: Alexandre Reymond, Ph.D. University of Lausanne, Switzerland alexandre.reymond@unil.ch +41-21-692-3961 Reference: Denoeud F. et al. 2007. Prominent use of 5 transcription start sites and discovery of a large number of additi...

Slow wave activity during sleep is lower in African-Americans than Caucasians

..."Lower levels of SWA in African-Americans could be related to their reported poor sleep quality and higher risk for insulin resistance." The amount of sleep a person gets affects his or her physical health, emotional well-being, mental abilities, productivity and performance. Recent studies associate lack...

High cholesterol diets modify gene expression in atherosclerosis

...ses changes in messenger RNA synthesis in proteins related to lipid metabolism control, proliferation and apoptosis (programmed cell death) and, therefore, that diet has an influence on gene expression. Through other studies, these experts discovered that, whilst cholesterol causes changes in gene expressi...

A fly lamin gene is both like and unlike human genes

...ve shown that the fly lamin genes are more closely related to each other than to mammalian lamin genes. While the independent evolution of similar expression patterns must have been driven by similar vital lamin gene functions, Dushay et el. found that mutations in the ubiquitously expressed Drosophila lamin...

NIH awards nearly $21 million to fund cutting-edge research equipment

...c Health (Madison, Wis.)$1,499,745.A cyclotron and related devices for positron emission tomography tracer development and production will enable molecular level physiological functional imaging to facilitate research involving cancer, neuroscience, cardiovascular, and regenerative medicine. Vanderbilt Un...

Scientists decode RNA mystery, will help aim drug therapies

...and, have found the difference between two closely related components in the messenger RNA (mRNA) near-cognate and non-cognate codons terms that have long been used, but not understood. Although these two terms have been used by scientists for over 40 years, the differences between them have never been ...

Physicist cracks women's random but always lucky choice of X chromosome

...cial to survival and problems with the process are related to serious genetic diseases. Both X chromosomes in a cell have a suicide gene called XIST which, if activated, seals the chromosome behind a barrier of RNA preventing the activation of any other gene. Researchers believe that this suicide gene can ...

BRCA2 carriers at increased risk for deadly form of prostate cancer

...cer risk, but it has been unclear whether they are related to progression of the disease. Laufey Tryggvadttir of the Icelandic Cancer Registry and colleagues compared survival and disease progression in prostate cancer patients with the Icelandic BRCA2 999del5 founder mutation and those without the mutatio...

Breakthrough developments in rheumatoid arthritis reported

...lso of The Feinstein Institute, will be presenting related studies on biomarkers and genetic influences on drug response at the same meeting. Identifying Immune System Mediators About one percent of the US population will develop rheumatoid arthritis, an autoimmune disease that leads to painful join...

Genetic defect links respiratory disease and congenital heart disease

... research team wondered if PCD and heterotaxy were related becauseother types of cilia, called nodal cilia, are known to play a role in directing and organizing organs in developing embryo. Results of the new study indicate they are connected. The prevalence of heterotaxy and congenital heart defects was 2...

Making new teeth

... labial (front) side. Subtle variations in this or related regulatory networks may explain the different regenerative capacities and asymmetric development of various organs and animal species....

Los Alamos National Laboratory making progress in Groundwater Protection Program

...s concerns about how drilling and other activities related to the installation of monitoring wells could alter the natural conditions around sampling points, and to support monitoring efforts in the future. LANL should conduct geochemical research on contaminant interactions, as well as other studies that w...

1 2 3 4 5 6 7 8 9 10

(Date:4/17/2014)... recent Yokahama IPCC meeting painted a stark warning on ... which has a greenhouse effect 32 times that of ... shown that humic substances act as fully regenerable electron ... are held in wetlands instead of being released to ... system is disrupted it may enter into a vicious ...
(Date:4/17/2014)... the genetic information of DNA is used to ... numerous different functions in living organisms. Messenger RNA ... expression, by relating the genetic information of DNA ... , By examining the different types and ... at a given time, researchers can determine which ...
(Date:4/17/2014)... way the immune system may fight cancers and viral ... cells to treat illness. , The research, in mice, ... "neighborhood police" specialized squads of defenders that patrol ... entire city, the body. , Scientists at Washington University ... the liver, skin and uterus each has dedicated immune ...
Breaking Biology News(10 mins):Methane climate change risk suggested by proof of redox cycling of humic substances 2Rapid and accurate mRNA detection in plant tissues 2Some immune cells defend only 1 organ 2
Other Tags
pandoraswettergrasslandsleftieshygieniccapacitiesmusculaturemirnasawaresummitkyotoesabrachytherapyinversetemporarilysue