Tag: "resolution" at biology news

New Stanford center probes nanoscale material

...ng other advantages allows for much higher spatial resolution in imaging. He will collaborate with other CPN researchers to adapt this technique for a variety of measurements. Kyeongjae Cho and Adrian Lew, multi-scale modeling experts from the Mechanical Engineering Department, will help other investigators und...

Three years of Proba, the 'smart' satellite that runs itself

...led data on the Earth's surface. It sees down to a resolution of 18 metres, in a combination of up to 19 out of ...now making use of CHRIS results. Its high spatial resolution make its data especially useful as a 'bridge' between results from satellite instruments such as Env...

New method studies living bacterial cells

...No previously available techniques had the spatial resolution needed to analyze individual bacterial cells noninvasively and nondestructively. Recent developments at the Advanced Photon Source (APS) at Argonne enabled the production of X-ray beams small enough to probe single bacterial cells, which are typicall...

Research to explore revolutionary gene sequencing: Threading the molecular needle

...ze the surface structure of materials at molecular resolution with the ultra-small tip of a sensitive probe, in combination with naturally occurring ring-shaped sugar molecules called cyclodextrins. Lindsay believes that the ring molecules, when paired with the AFM probe tip, can effectively be used as sensors...

Building a tree of life needs less 'wood'

...nformation from sequence databases, increasing the resolution of phylogenetic trees, he said. ...

New findings in innate immunity may lead to treatments for atherosclerosis

...play a significant role in the pathogenesis and/or resolution of atherosclerosis," explains Dr. Li. "Anti- infla...lays a critical role in either the pathogenesis or resolution of atherosclerosis. IRAK1 may provide a viable target for developing therapeutic interventions for a...

Revisiting the vertebrate invasion of the land

... from complete, new discoveries have increased the resolution of the morphological sequence, documented the relative rapidity and geographic distribution of the tetrapod appearance, and fueled new controversy over the environmental and biological factors involved. Topics in this state-of-the-art issue range fro...

Wobble hypothesis stands up, NC state researcher finds

...ore than one three-letter code. Using atomic-level resolution in which researchers can distinguish atom from atom and working with a tRNA specific for the amino acid lysine, Agris and his colleagues show modified nucleosides enabling tRNA to decode genomic information on the ribosome, the cell's protein synth...

Birds, butterflies, bacteria same law of biology appears to apply

...ifferent "types" apart. It's a different taxonomic resolution than species, Green says, but it is a consistent measure of community composition. Green and her co-authors sampled the microbial fungi Ascomycota in desert soils of a 62-square-mile national park in Australia. The Horner-Devine paper was based on ba...

UCSB makes important advances in studies of retinal detachment

...n that the researchers have specialized using high resolution microscopy techniques to precisely map changes in protein expression and morphology in the cells. ...

Satellites plus software equal best-ever Mediterranean heat map

...oduct is being created to an unprecedented spatial resolution of two square kilometres, as Ian Robinson of the S...sociated with the dynamics of water circulation. A resolution as fine as this is needed to allow these features to be properly tracked." The remaining ocean pro...

High-flying observatory reveals land changing to desert

.... The data are viewed in 3-dimensions at very high resolution and can give a much broader picture of the processes at work, including carbon cycling and other chemical and biological activities. The entire study region was about 500 square miles (800 square kilometers). Each data pixel covered an area 62 feet...

Story tips from the Department of Energy's Oak Ridge National Laboratory, January 2005

...e structure of a butterfly's wing. The 5-nanometer resolution images, obtained with a technique called atomic force acoustic microscopy, depict the infinitesimally complex structures that underlie the functionality and delicate spectacle of the flying insect's wing. Using the instrument, researchers can see nan...

New lensless imaging technique opens door to nanoscale world

...to take direct images with 10 times better spatial resolution than can be achieved with current X-ray lenses and...tic regions of a cobalt-platinum film to a spatial resolution of 50 nanometers (50 billionths of a meter)....

Satellite data to track wildlife: Elephants in space

...scientists say that they will be able to take high resolution photographs of specific areas to determine the wildlife composition within that area. They will then compare images from different dates to see changes, either population growth or decline, over time. The satellite, called Quickbird, is owned by Digi...

Desertification alters regional ecosystem climate interactions

.... The data are viewed in 3-dimensions at very high resolution and can give a much broader picture of the processes at work, including carbon cycling and other chemical and biological activities. The entire study region was about 500 square miles (800 square kilometers). Each data pixel covered an area 62 feet...

Powerful X-ray beams at Argonne, new electronic flight simulator

...rating the rapid contractions of the muscle with a resolution of 6/10,0000th of a second. The flight simulator, which fools a tethered fly into "thinking" it is flying freely through the air, is necessary to produce a stable pattern of wing motion and enabled the researchers to capture X-ray images at different...

B-15A iceberg's close encounter monitored by Envisat

...ntarctic view The 400-kilometre swath, 150-metre resolution images shown here of B-15A and the Drygalski ice t...l Monitoring Mode (GMM), with the same swath but a resolution of one kilometre, enabling rapid mosaicking of the whole of Antarctica to monitor changes in sea ice...

Born to run? Capacity for aerobic exercise linked to risk of heart disease

ANN ARBOR, Mich. If your New Year's resolution to exercise is now just a distant memory, there are some rats at the University of Michigan Medical School that may convince you to climb back on the treadmill. A new research study, to be published in the Jan. 21 issue of Science, found that rats s...

Scientists find missing link between whale and its closest relative, the hippo

...ite at UC Berkeley, Boisserie decided to attempt a resolution of the conflict between the molecular data and the fossil record. New whale fossils discovered in Pakistan in 2001, some of which have limb characteristics similar to artiodactyls, drew a more certain link between whales and artiodactyls. Boisserie a...

1 2 3 4 5 6 7 8 9 10

(Date:11/12/2014)... 12, 2014 Crossmatch™, a leading provider of ... ® fingerprint readers have been deployed throughout Montparnasse ... Central Mexico . The bakery chain implemented the ... issues caused by employees clocking in for each other. ... readers, Montparnasse relied on paper timecards and a mechanical ...
(Date:11/7/2014)... Dr. Debra Auguste, associate professor, biomedical engineering, in ... College of New York, have identified a molecule ... of the most aggressive forms of breast cancer. ... high mortality rate owing to aggressive proliferation and ... However, Professor Auguste,s team, discovered the overexpression of ...
(Date:11/6/2014)... groundbreaking paper from a team of Florida State University ... plants could adapt to and survive environmental swings such ... the latest issue of the journal The Plant ... of DNA and proteins) is organized in a cell ... genes are turned on and others are turned off. ...
Breaking Biology News(10 mins):Montparnasse Pasteleria Achieves Time and Attendance Transparency with Crossmatch U.are.U Fingerprint Readers 2Maize analysis yields whole new world of genetic science 2
Other Tags
bloomduecorpsesmellyvalvesimplifyarisingschrenkinsurancecirrhosiscelecoxibtooculpritfindresearchersstanford