Tag: "risk" at biology news

Injection drug use and HIV and HCV infections among Ontario prison inmates

...studies, injection drug use was the most important risk factor, and the prevalence of hepatitis C virus (HCV) infection was much higher than that of HIV infection. Given the high rates of recidivism and the short stays in remand facilities and provincial prisons, the results of these studies have importan...

Injection drug use the most important risk factor for HIV and HCV infections among Quebec prisoners

...studies, injection drug use was the most important risk factor, and the prevalence of hepatitis C virus (HCV) infection was much higher than that of HIV infection. Given the high rates of recidivism and the short stays in remand facilities and provincial prisons, the results of these studies have importan...

First new multiple sclerosis gene found in 30 years

...ve identified a gene that increases an individuals risk of MS by 30 percent and that this variant has an e...e exact same genetic change in IL-7R increased the risk of multiple sclerosis to a very similar extent in four different populations. Multiple sclerosis i...

GI Caramba! Blue tortillas may help dieters and diabetics

...d to have long-term health benefits, reducing your risk of heart disease and diabetes as well as aiding an...ome, a combination of disorders which increase the risk of heart disease, stroke and diabetes. NB The blue colouring is due to the presence of anthocyanin...

After a decades-long search, scientists identify new genetic risk factors for multiple sclerosis

...f Health has revealed two genes that influence the risk of getting multiple sclerosis (MS) data sought si...team, which scanned the entire human genome for MS risk factors, was co-led by David Hafler, M.D., Professor of Neurology at Harvard Medical School and Brig...

Risk genes for multiple sclerosis uncovered

...helping us to pinpoint genes that may elevate the risk of developing MS and other autoimmune diseases, po... able to deliver the most exhaustive search for MS risk factors ever published. In an effort to see the work extended, we are now committed to making the en...

Nottingham biosciences million pound injection

...one, chronic post-operative pain, and an increased risk of infection. Injectabone will be launched in the US and European markets for use by orthopaedic surgeons. The material will then be adapted to help in treatment of many other diseases. Dr Robin Quirk, Managing Director, said: Regenerative medici...

New research identifies anti-viral protein that may predict who might be at risk to develop lupus

...w more, they may be able to identify those at high risk and diagnose the condition early enough to interve...levels as a measurement to predict who might be at risk to develop this disease, says Dr. Crow, who is the immediate past president of the American College ...

Prenatal stress keeps infants, toddlers up at night, study says

...nxious or depressed mothers-to-be are at increased risk of having children who will experience sleep problems in infancy and toddlerhood, finds a study that published this month in Early Human Development. While this finding presents itself as important news to tired new moms and dads for whom a soundl...

Nanowaste needs attention of EPA, industry and investors

...g for future potential liabilities. Central to all risk management efforts is the need for the EPA to conduct outreach and education to the private sector, particularly to small companies and start-ups, about how RCRA and CERCLA could apply to nanomaterials. Today, with hundreds of nanotechnology produc...

U-M researchers identify gene involved in breast cancer

... BRCA2 genes, both of which are linked to a higher risk of breast cancer. FOXP3 defects promote cancer development. We do not know whether this is a genetic defect that puts women at higher risk. For treatment, this gene could be quite important, but for diagnosis, its too early to tell, says study auth...

FDA Nanotechnology Task Force takes positive step forward

...ls, greater nano-specific staff expertise and more risk research to assess the likelihood of long-term health effects from exposure to specific nanoscale materials. The report also recognizes the need to gather more information from industry, especially to answer safety-related questions, and to provid...

FDA sees nanotech challenges in every product category it regulates

... report clearly states that size matters in making risk management decisions. Because the chemical, physic...sight of nanotechnology by the dearth of available risk research data on nanomaterials. Because the agency is resource-starved, there are scant funds for FD...

Study points to new way to predict death risk from torn aorta

...t have a reliable way of predicting who is most at risk of dying, and who might benefit most from surgery ..., propose a new way to predict post-hospital death risk for aortic dissection patients, and a new model for the mechanism behind that risk. Their model f...

UCLA study links air pollution to clogged arteries

...f the arteries, which significantly increases ones risk for heart attack and stroke. Published in the July... genes that promote cellular inflammation a major risk factor for atherosclerosis, said Dr. Jesus Araujo, UCLA assistant professor of medicine and director...

Other highlights in the July 24 JNCI

... to use menopausal hormone therapy with the lowest risk of negative effects and to the greatest advantage,... hormone levels and breast density are independent risk factors for breast cancer in postmenopausal women. Breast density and hormone levels are both well...

Breast cancer and hormone therapy -- A looking-glass mirror?

...rmone therapy (HT) use is associated with a higher risk of breast cancer, says Professor Amos Pines, Presi... women per year. Discontinuation of HT brings this risk back to the values for age-matched non-users after 35 years. Weighing the overall benefits and risks...

Prenatal alcohol exposure alters brain activity in the frontal-striatal areas

...to the study, individuals with FASD are at greater risk for attention deficit hyperactivity disorder and other psychiatric diseases linked with poor inhibitory control. Also, in a possible reflection of poor behavioral regulation, individuals with histories of prenatal alcohol exposure are thought to be ...

Picky eating potentially perilous for bats

...y of a link between dietary specialization and the risk of extinction for bats in Australia, Europe and No... previously found to be associated with extinction risk in bats. Previous research has shown that habitat loss, roost availability, and gregariousness inf...

New model for autism suggests women carry the disorder and explains age as a risk factor

...increase with age places older parents at a higher risk of having children with autism, explaining a patte...Wigler, Ph.D. The model proposes two prominent risk classes for families affected by autism. Low risk families give rise to sporadic autism, the more co...

1 2 3 4 5 6 7 8 9 10

(Date:6/17/2013)... CORVALLIS, Ore. Amphibian populations are declining worldwide and ... be spread by bullfrogs, but a two-year study shows ... suggestions that bullfrogs are a tolerant carrier host that ... frogs from eggs in controlled experimental conditions, they found ... dendrobatidis , also called Bd or a chytrid fungus, ...
(Date:6/16/2013)... prevention programs for female sex workers in India reduce ... (STIs), a University of Toronto study has found. ... HIV, mostly in the southern states of Andhra Pradesh, ... Professor Prabhat Jha from U of T,s Dalla Lana ... for Global Health Research (CGHR), examined the impact of ...
(Date:6/16/2013)... ago triggered a similar marine ecosystem crisis to those ... warming, according to research published today in Nature ... universities of Newcastle, UK, Cologne, Frankfurt and GEOMAR-Kiel, confirms ... the marine ecosystem during the mid-Cretaceous greenhouse period. ... amplitude and duration of the temperature change.,Analysing the geochemistry ...
Breaking Biology News(10 mins):Bullfrogs may help spread deadly amphibian fungus, but also die from it 2HIV prevention among female sex workers in India reduces HIV and syphilis 2Global cooling as significant as global warming 2
Other Tags
comparablemarimastatketektenthdarklyairwayeditsfluorideappropriationsconveysasmusualunprovengambiaopposeshivma