Tag: "safe" at biology news

Nanotech safety needs specific government risk research strategy and funding

...rder to lay a strong, science-based foundation for safe nanotechnology." According to Maynard's analysis, despite investing more than $1 billion annually on nanotechnology research, U.S. government spending on highly relevant nanotechnology risk research is only $11 million per year....

Highlights from the January 2007 Journal of the American Dietetic Association

...n neighborhoods perceived by their parents as less safe for outdoor play are more likely to be overweight from kindergarten on. "Intervening quickly on children's behalf is of the utmost importance," the researchers write. "Clinical overweight among this age group tracks notably into adulthood." The res...

Ocean temperature predicts spread of marine species

...tected area can get to another area where they are safe from harvest. "In warmer waters, marine protected areas may need to be closer together than in colder water, since in warmer water dispersal distances tend to be shorter," O'Connor said. While a one degree increase in temperature at the ocean surfa...

Development of gene therapy

...ecially regarding the development of efficient and safe vectors for gene transfer....

Structure of iron regulatory protein-RNA complex solved

...in internal iron concentrations at the appropriate safe and useful levels and is important to the future design of therapeutic targets," Walden said. IRP1 is a very large protein, composed of about 900 amino acids arranged into four major domains. "We expected that IRP1 would open up the two major dom...

Protection against cancer may begin during pregnancy

...rmal diet rich in cruciferous vegetables should be safe and useful, they said. These vegetables include broccoli, cabbage, cauliflower, kale, radishes, turnips and other types of greens and cabbages. Indole-3-carbinol is also being studied by scientists in other U.S. research programs for chemoprotection...

Relative abundance of common microbes living in the gut may contribute to obesity

...onally manipulate our gut microbial communities in safe and beneficial ways to regulate energy balance?"...

History-hunting geneticists can still follow familiar trail

...g against the dogma. This study shows the dogma is safe in mammals and probably in vertebrates, as well."...

AZTI-Tecnalia obtains isomers of conjugated linoleic acid from micro-organisms

... is possible, by using micro-organisms accepted as safe in the preparation of foodstuffs. Thus, it is to be hoped that, by means of using these micro-organisms, functional foodstuffs can be prepared without recourse to chemical synthesis....

Study reveals noisy Christmas toys can damage hearing

...the guns, there is a potential for harm but theyre safe if used sensibly. With most toys, your child will ...impossible to set an objective noise level that is safe for all. Provided the ear is allowed ample rest afterwards, a level of 80 dBA might be tolerated for...

Eculizumab is well-tolerated and shows significant improvement in PNH patients (Ph III)

...armaceuticals, Inc. (Nasdaq: ALXN), appeared to be safe and well tolerated and provided clinically and statistically significant improvements in intravascular hemolysis, anemia, fatigue and quality of life in patients with paroxysmal nocturnal hemoglobinuria (PNH) during the 52 weeks of treatment in the P...

Ebola-outbreak kills 5000 gorillas

...wo or three million dollars necessary to develop a safe and effective way of delivering Ebola vaccine to wild apes." Walsh contends that Ebola vaccination is a cost effective method of ape conservation. "People in the conservation community are intimidated by the up-front costs of vaccination and would ...

NIH selects Purdue to use phi29 DNA packaging motor for National Nanomedicine Development Center

...nism. Liposomes have been clinically accepted as safe and should be able to protect the DNA and cause no harm to the human body, Thompson said. They also can be engineered to target a specific pathologic cell. The team will have to create a synthetic liposome compatible with the nanomotor and find a way...

Evolution of typhoid bacteria

... Furthermore, the healthy carrier state provides a safe reservoir for these bacteria which allows them to evade short-term antibiotic treatment and vaccination, indicating that typhoid fever will remain a major health problem for the foreseeable future....

Got cotton? Texas researchers' discovery could yield protein to feed millions

...und from cottonseed to a level that is considered safe for consumption," said Dr. Keerti Rathore, Texas Agricultural Experiment Station plant biotechnologist. "In terms of human nutrition, it has a lot of potential." The cottonseed from these plants meet World Health Organization and U.S. Food and Drug A...

Gene therapy for hereditary lung disease advances

...y end point in the trial was to see whether it was safe to give patients this gene transfer vector and the...d by the FDA and research community to ensure that safe and good clinical studies are employed in these early days, and I applaud Terry Flotte and his group...

Tips from the Journals of the American Society for Microbiology

...pon of mass destruction reinforcing the need for a safe and effective vaccine. There is currently no licensed vaccine available in the U.S. In the study select guinea pigs received a killed whole-cell Q fever vaccine after which all were infected with C. burnetti through inhalation of small-particle aer...

New genetic test predicts risk of metastasis in patients with deadly eye cancer

...For the first time, we have demonstrated that it's safe and feasible to perform a biopsy in the living eye to obtain clear results about whether a tumor has metastatic potential or not," explained Dr. Tara Young, assistant professor of ophthalmology at UCLA's Jules Stein Eye Institute and a Jonsson Compre...

Specter of possible harm threatens nanotech development, experts say

...nd scientists around the world are willing to make safe nanotechnology a priority. Are they willing devote..., then we can surely look forward to the advent of safe nanotechnologies."...

Researchers to present advances in energy, health, technology at chemical engineering conference

... Dai is pursuing another method that might be more safe and effective: storing hydrogen in carbon nanotubes. On Wednesday, Nov. 15, at 3:15 p.m., graduate student Yong-Won Lee will describe research showing that carbon nanotubes can store more than four times more hydrogen when peppered with the metal pal...

1 2 3 4 5 6 7 8 9 10

(Date:5/16/2013)... -- Injectable nanoparticles developed at MIT may someday ... diabetes to constantly monitor their blood-sugar levels and ... designed to sense glucose levels in the body ... insulin, thereby replacing the function of pancreatic islet ... 1 diabetes. Ultimately, this type of system could ...
(Date:5/16/2013)... relationship between the heritable risk for schizophrenia and ... is commonly associated with cognitive impairments that may ... IQ may be linked to the risk for ... precede the onset of schizophrenia symptoms. Also, these ... people diagnosed with schizophrenia. , In a remarkable ...
(Date:5/16/2013)... May 16, 2013 Integrated Biometrics patented ... a custom thin film transistor camera introduces Sherlock, ... roll image in the smallest and lightest form ... Appendix F Mobile ID FAP 45, Certified scanner ... in size and weight when compared to optical ...
Breaking Biology News(10 mins):Nanotechnology could help fight diabetes 2Nanotechnology could help fight diabetes 3Genetic risk for schizophrenia is connected to reduced IQ 2
Other Tags
sarawakmalaysianweevilnicetrendupwardpredisposingemphasiscouricmovieadvisestraymitigatesolicitousnessgastroenteritisgatorade