Tag: "samples" at biology news

Study identifies key aspect of immune response against HIV

...y those molecules. The researchers analyzed blood samples from 375 HIV-infected patients at the Doris Duke M... cells that are destroyed by HIV and that analyzed samples from Australian patients infected with a different strain of virus all supported the conclusion that...

Children's Hospital Boston launches major genetic study of autism

.... Children and their parents will then give saliva samples for DNA analysis and blood samples for RNA gene expression studies. Led by Drs. Ingrid Holm and Louis Kunkel, researchers in the Chil...

Nanotubes glow, even within biological cells

...g ingested through normal phagocytosis. The samples were studied using a spectrofluorometer and a fluorescence microscope that was modified for near-IR imaging through the addition of a digital camera containing indium gallium arsenide detector elements. Although long term studies on toxicity a...

International HapMap consortium widens data access

...e. To create the HapMap, DNA was taken from blood samples collected by researchers in China, Japan, Nigeria ...70 individuals providing the samples. However, the samples are identified by the population from which they were collected. The $130 million project, which was...

Scientists solve the mystery of how Botox attacks nerves and eliminates wrinkles

...aboratory analysis. Unfortunately, the botulinum A samples usually ended up slicing the SNARE target in two, rendering it useless. "The trick that Mark found was to introduce two specific mutations in the botulinum enzyme that would inhibit its function, but not to the degree that it would affect its structu...

Purdue scientists hunt for 'secret X' to treat liver cancer

...he X protein was feeding the cells, we worked with samples of mouse liver tissue in the lab," she said. "We f...ells, we watched the behavior of these mouse liver samples to see whether they conformed to healthy liver cell life cycles." To ease observation, they us...

Research points to new theory driving evolutionary changes

...undreds of museum specimens of dogs and from blood samples of volunteered live dogs, offer a new explanation for the sudden, rapid rise of new species found in the fossil record. They also help explain the variability in appearance among individual members of a species, such as the length of the nose in diff...

The secret life of acid dust

... wild card to deal with. Companion studies of dust samples from the Sahara and the Saudi coast and loess from China show that the higher the calcium in the mineral, the more reactive they are in with nitric acid. And once the particle is changed, it stays that way. "When dust storms kick up these particles a...

50,000-year-old plant may warn of the death of tropical ice caps

...urned to his campus lab, he packaged the three new samples and sent them off for carbon-dating as well. The f...d plant sample seemed radically skewed."We had the samples dated at the National AMS Facility at Woods Hole Oceanographic Institute (NOSAMS) and later sent oth...

Hummingbirds lose power at high altitudes

...variety of species." McGuire obtained DNA samples from museum specimens, relying mostly upon the tropical bird collections of the Museum of Natural Science at Louisiana State University in Baton Rouge, and analyzed two nuclear and one mitochondrial gene from each species. Though only 75 species are ...

Violent ocean motion no magic potion for reefs

...area. The researchers also collect water and algae samples whose chemical signatures are studied to determine if they more closely match the signatures of natural sources of nitrogen or of land-based pollution sources. This information can help clarify the most likely cause or causes of the HABs....

Tips from the Journals of the American Society for Microbiology

... effect of both has yet to be tested. In the study samples of ground chicken and chicken skin infected with C..."A significant portion of C. jejuni on the poultry samples studied survived during refrigerated, frozen, and combined refrigerated and frozen storage," say the...

New technique provides insights into gene regulation

...ls of mRNAs. An array is an orderly arrangement of samples of DNA. An experiment with a single DNA microarray can provide researchers information on thousands of genes simultaneously a dramatic increase in throughput from the era when only one gene could be studied at a time. The new system developed by the...

Hospital epidemiologists trace outbreak of organism to commonly used wound care equipment

...al-based infections. Culture results from patient samples of blood, sputum, urine and wounds also were reviewed. Specific samples, or isolates, of Acinetobacter were analyzed using pulsed-field gel electrophoresis, to determine and track the spread of the specific strain of the bacterium involved in the ho...

Ocean colour satellites guide research ship through South Pacific's watery desert

... Now the cruise has ended, water and phytoplankton samples frozen in liquid nitrogen have been distributed fo...hyll levels the hope is that detailed analysis of samples gathered here can resolve this apparent paradox. Proceeding east in early November led to an...

Federal/private partners launch resource for diabetic kidney disease gene studies

...idney disease. Also in the collection are data and samples from 1,096 parents (548 sets). "GoKinD is a tre... at www.gokind.org/access; serum, plasma and urine samples will be made available later. Methods of treatment, insulin doses, complications, smoking history an...

The death of a very special chimpanzee

...out whether more effort should be made to preserve samples from the individuals that are sequenced. "The ma... health: if researchers needed to take more tissue samples to validate the DNA sequence, he would be around to provide them. And as insights into the function ...

No blind mice, thanks to UF scientists

...ability to capture images. UF researchers analyzed samples of the vitreous gel taken from the eyeballs of 46 ...ses. No traces of SDF-1 were found in the vitreous samples of eight nondiabetic patients who were treated for other ailments. With the hypothesis that SDF-1 is...

Story tips from the Department of Energy's Oak Ridge National Laboratory, January 2005

...ssee's Henri Grissino-Mayer concluded that the two samples matched. Had the wood come from different trees the chemical fingerprints would have been different. Laser-induced breakdown spectroscopy is a technique that Martin and ORNL's Stan Wullschleger originally used for carbon sequestration applications su...

Scientists discover key genetic factor in determining HIV/AIDS risk

...se in San Antonio. The researchers analyzed blood samples from more than 4,300 HIV-positive and -negative people of different ancestral origins to determine the average number of CCL3L1 gene copies in each group. They found that, for example, HIV-negative African-American adults had an average of four CCL3L...

1 2 3 4 5 6 7 8 9 10

(Date:5/21/2013)... battle? Try staying fit in space, where living quarters ... , That,s the challenge a group of Michigan State ... million grant from NASA. Their goal is to keep ... "You could give astronauts the best exercise regimen there ... to it, it isn,t going to help," said project ...
(Date:5/21/2013)... biomass experts , Where? Copenhagen, Denmark: ... 03-07 June 2013 , Why? ... market and policy developments, manufacturing and installation, drawing on ... from its 2013 edition from a record of more ... more than 240 plenary and oral presentations, more than ...
(Date:5/21/2013)... The epigenetic modifications, which alter the way genes ... apparently be detected in the blood of pregnant ... way to foretell depression in the weeks after ... symptoms become debilitating. , The findings of the ... online in the journal Molecular Psychiatry . ...
Breaking Biology News(10 mins):Fueling fitness on the final frontier 221st European Biomass Conference and Exhibition 221st European Biomass Conference and Exhibition 321st European Biomass Conference and Exhibition 4Genetic predictors of postpartum depression uncovered by Hopkins researchers 2Genetic predictors of postpartum depression uncovered by Hopkins researchers 3
Other Tags
deficitmammarymissilesguidedcoloradoinfluencesculturealoneopensdocumentedruinousmethamphtetamineflycheckfacedmetacognition