Tag: "secret" at biology news

Facial attraction -- choice of sexual partner shaped the human face

...open-access journal PLoS ONE. The face holds the secret to determining the sex of our ancestors and what makes us attractive to the opposite sex for reproduction. According to palaeontologists at the Natural History Museum, men have evolved short faces between the brow and upper lip, which exaggerates ...

Secret life of elephant seals not secret anymore!

...ded scientists with an unprecedented peek into the secret lives of seals. The measurements reveal in detail where the seals go on their winter feeding trips, where they find food and where they dont, and help explain why some populations have remained stable since 1950 while others have declined. The re...

Switchable adhesive

...ut the scientists led by Mark Geoghegan reveal the secret of their intelligent adhesion in the journal Angewandte Chemie. One of the surfaces involved consists of a polyacid gel, a three-dimensionally cross-linked polymer containing many acid groups. This polymer network is so heavily soaked in liquid tha...

Microscopic jets, diamonds unlikely on Uranus, and amazing mosquito legs

...ey pushed it down into a container of water. The secret to mosquito water walking appears to be feathery scales a few microns across that in turn are covered with nanoscopic ribbing, forming what the physicists have dubbed (in an apparent fit of excessive prefixing) a micronanostructure. So the next time ...

UVa-led team uncovers important secret in gene replication

...ia Health System geneticists has uncovered a major secret in the mystery of how the DNA helix replicates itself time after time. It turns out that it is not just the sequence of the bases (building blocks) in the DNA, but also how loosely or tightly the chromatin (the material that makes up chromosomes) is ...

Presidential Recognition Awards presented at the 2007 AIUM Annual Convention

...uently as committee chairs, and their names remain secret until the presentation ceremony. Dr Frates has been involved in the AIUM Clinical Standards Committee for the last 7 years and has chaired the committee since 2004. Dr Frates is an AIUM fellow who has been a member since 1991 and has served the ass...

Little lifesavers -- Nanoparticles improve delivery of medicines and diagnostics

...h problems, including cancer and tuberculosis. The secret is the size of the package. Using an innovative technique they invented, a Princeton University-led research team has created particles that can deliver medicine deep into the lungs or infiltrate cancer cells while leaving normal ones alone. Only 1...

Ultrathin films deliver DNA as possible gene therapy tool

... DNA] back out of the films is the hard part." The secret to films that release DNA is in the choice of the polymer and the layer-cake design. The researchers alternate layers of DNA with layers of a polymer that is stable when dry but that degrades when exposed to water. Because the polymers carry a posi...

Researchers learn what sparks plant growth

A secret long held by plants has been revealed by Howard Hughes Medical Institute researchers. The new discovery, which builds on more than a decade of painstaking surveillance of cellular communication between different types of plant tissues, shows clearly ...

Largest physics meeting of the year, in Denver

...ing ultra-fast database searches, rapidly cracking secret encrypted codes, and greatly improving molecular-level simulations for designing drugs and other new materials. In session N2, researchers will describe quantum-computer designs based on a newer approach, the use of superconducting electronic compone...

The secret of Dutch tapwater unveiled in new textbook

...nking Water Principles and Practices' unveils the secret of this Dutch miracle. In the Netherlands we take it for granted that our drinking water is safe and tastes well. But in most countries, tap water is used to flush the toilet only, and not for drinking. Bottled water or in- house filters for purify...

Nectar is not a simple soft drink

... field season. Dissecting the function of this secret formula of nectar, thought to be nature's soft drink, has instead shown it to be quite 'hard'....

Pregnancy hormone key to repairing nerve cell damage

...into remission while women are pregnant may be the secret to overcoming the devastating neurodegenerative disease, according to University of Calgary researchers who have shown that a pregnancy-related hormone is responsible for rebuilding the protective coating around nerve cells. In a paper to be publis...

Winners of the 2006 AAAS Science Journalism Awards

...s. Why? Quite by accident, the researchers found a secret defense system in living cells, a gene-silencing mechanism called RNA interference. It has become one of the hottest topics in biology and was the subject of the recently awarded 2006 Nobel Prize for Medicine or Physiology. In addition to the RNAi se...

Noise echoes in cell communications

.... "There is no life without noise; noise is the secret of life," suggests Martin, who points to the constant movement of particles under a microscope to illustrate this phenomena. Unlike a physics experiment that can produce the same result after various attempts, in biology, one particular experiment ca...

UCF student's research with Disney giraffes may help conserve several species

...ANDO, Jan. 29, 2007 -- Giraffe poop could hold the secret to protecting the species for years to come. University of Central Florida doctoral student Jennifer Fewster is studying giraffe excrement at Disneys Animal Kingdom Lodge in Lake Buena Vista in an effort to figure out what the animals eat in the wi...

Disorderly protein brings order to cell division

The secret to the ability of a molecule critical for cell division to throw off the protein yoke that restrains its activity is the yoke itselfa disorderly molecule that seems to have a mind of its own, say investigators at St. Jude Children's Research Hospital...

'Biomimetic Technologies' project will create first soft-bodied robots

...lty-staff/kaplan.asp ) , has already uncovered the secret of how spiders and silkworms are able to spin webs and cocoons made of incredibly strong yet flexible fibers. More recently, his team applied genetic engineering and nanotechnology to create a "fusion protein" that for the first time combined the tou...

Complex channels

...re recently published in the journal Neuron. The secret is in the control over electrical signals generated by cells. These signals depend on ion channels membrane proteins found in excitable cells, such as nerve cells that allow them to generate electrical signals, depending on whether the channels are...

MIT: Nanocomposities yield strong, stretchy fibers

...last few years scientists have determined that the secret behind the combined strength and flexibility of spider silk lies in the arrangement of the nano-crystalline reinforcement of the silk while it is being produced. "If you look closely at the structure of spider silk, it is filled with a lot of ver...

1 2 3 4

(Date:4/17/2014)... hundred births, Down syndrome - or trisomy 21 - ... It results from a chromosomal abnormality where cells of ... (1% of the human genome). A study conducted by ... Genetic Medicine and Development at the University of Geneva ... shed light on how the extra chromosome 21 upsets ...
(Date:4/17/2014)... Clemson professor Rajendra Singh Thursday as a "Champion ... expand solar deployment in the residential, commercial and ... Professor of Electrical and Computer Engineering and director ... a local hero leading the charge across the ... solar power and driving policy changes at the ...
(Date:4/17/2014)... such as heart disease, epilepsy and pain, making them ... is still much scientists do not know about the ... into the structure of sodium channels and, specifically, one ... responsible for ,fine-tuning, the activity of the channel. The ... the Journal of Biological Chemistry . , Nerves ...
Breaking Biology News(10 mins):Trisomy 21: How an extra little chromosome throws the entire genome off balance 2Trisomy 21: How an extra little chromosome throws the entire genome off balance 3White House honors Clemson professor as 'Champion of Change' for solar deployment 2Structure of sodium channels different than previously believed 2
Other Tags
architectsbeaverrunawaycaspaseclindamycinplentifulpertussisimmunogenicityallergenillnessessupplementsherbalprofessorshipbassetspaceddocument