Tag: "shoulder" at biology news

Old bones unearth new date for giant deer's last stand

...oolly mammoth. The magnificent beasts 2 metres in shoulder height with antlers spanning 3.5 metres - appear to have made their final stand in the Ural mountains on the boundary of Europe and Asia, possibly the last haven for a species which was being progressively wiped out by climate change and the spread o...

ASU gets grant to develop high speed DNA sequence reader

...t reads. "We have a way to look over the enzyme's shoulder as it does its job," Williams said. "We are going to use this little biomechanical marvel to report back on sequences." The technique's high speed and low cost come from the idea of multiplexing, reading tens of thousands of DNA base pairs simultane...

New fossil may be closest yet to ancestor of all great apes

...added. In addition, Pierolapithecus ' shoulder blades lie along its back, as do those of modern great apes and humans. In monkeys, the shoulder blades are on the sides of the ribcage, the way they are in dogs. In both Pierolapithec...

Research led by UGA professor reports first routine tool use by wild capuchin monkeys

...ands and raised and lowered the stone with arm and shoulder movements. A more strenuous method involves a monk...n by standing explosively and raising the stone to shoulder height before crashing it down on the nut. Though such behavior has been seen in captive capuchins, ...

Brain controls robot arm in monkey, University of Pittsburgh researcher reports at AAAS

...moves much like a natural arm, with a fully mobile shoulder and elbow and a simple gripper that allows the monkey to grasp and hold food while its own arms are restrained. Computer software interprets signals picked up by tiny probes inserted into neuronal pathways in the motor cortex, a brain region where vo...

Grizzlies set to invade high Arctic?

...racteristic grizzly features including a prominent shoulder hump, dark brown hair on and around the rear legs, and faded (grizzled) hair on the rest of the body. Then in the summer of 2004, Dr. England's research group found physical proof that a grizzly bear was indeed calling Melville Island home. Near a ca...

The ultimate spa: embryonic body wash controls left-right development

...ree angle, rather like a twirling parasol over the shoulder of a Southern Belle. Their live (in vivo) observations feature in the current Cell article. The cilia, which twirl at 10 cycles per second, were too fast for conventional video recording and so the scientists captured their complex movement on a spec...

MIT develops 'Anklebot' for stroke patients

...These include one for the spatial movements of the shoulder and elbow, one for the wrist and one for the hand. "We've seen hints that generalization [from one machine] is limited, and to deliver optimal therapy clinicians need a gym of robots," said Krebs. Most recently the team created a prototype for therap...

Scientists discover stem cell origin of neck and shoulders

...us groups of stem cells making up the bones of the shoulder and neck and another making the muscles, a newly-d...ing muscles also makes the skeletal regions of the shoulder girdle. This sheds new light on human diseases such as Klippel-Feil syndrome where both regions are ...

K-State professors discover enzyme responsible for creation of a beetle's hard shell

...ch Bill Snyder develop better football helmets and shoulder pads for his players," he said. Collaborative research with scientists at the University of Kansas is in the beginning stages to analyze quantitatively the mechanical properties of insect cuticles and to perform cuticle protein cross-linking experim...

$3.5 million from Homeland Security for lie detection in the 21st century

...are studying how a person's subtle body movements shoulder shrugging, hand gestures or slight changes in facial expression may indicate that a person is being deceptive. The goal is to capture these nonverbal cues on camera, have a computer analyze them and deliver immediate input on the subject's likely tr...

Extinct giant deer's descendant found in UK

...would have towered over its descendant, reaching a shoulder height of around two metres with antlers spanning 3.5 metres (10 feet). Deer from around the world (including the southeast Asian axis deer, the hog deer and fallow deer) were DNA tested and their characteristics - such as antlers, skull and teeth si...

Defect in gene causes 'neuralgic amyotrophy'

...ease causes prolonged acute attacks of pain in the shoulder or arm, followed by temporary paralysis. Researchers from the Flanders Interuniversity Institute for Biotechnology (VIB) connected to the University of Antwerp, have uncovered a small piece of the molecular puzzle of this disease by identifying the d...

Sustainable agriculture: Canadian institute offers definition, recommends path

...ons grow but can only happen if all Canadians help shoulder the load. Adding a levy to groceries, with rebates for low-income citizens, would be the simplest way to create a fair levy to help farmers meet growing public demands for safe food produced in ways that do not sacrifice the environment, the discuss...

Ultrasound a diagnostic tool for space, sports and more

...ss a number of injuries such as trauma to the eye, shoulder or knee, tooth abscesses, broken or fractured bones, a collapsed lung, hemorrhaging, or muscle and bone atrophy. It normally takes 200 hours plus yearly updates to learn to operate ultrasound, but Dulchavsky and his team developed an education metho...

Hearing loss from chemotherapy underestimated

...aring loss resulting from the chemotherapy for the shoulder tumor has been the most disabling. "The hearing lo...ut a year after his chemotherapy treatment for the shoulder tumor ended. "What I don't think the general public understands is that surviving cancer isn't the s...

Hopkins researchers discover genetic switch that turns off an oxygen-poor cell's combustion engine

...ns, Dang explained. Instead, glycolysis is left to shoulder the burden of making ATP by being prodded into overdrive by HIF-1. And left to itself during hypoxia, the mitochondrion produces reactive oxygen species that threaten the life of the cell. "But our discovery clearly shows that hypoxia doesn't simply...

Sentinel lymph node biopsy associated with better quality of life in breast cancer patients

...unpleasant side effects, such as decreased arm and shoulder function. For women with early-stage breast cancer, this type of surgery has little benefit, and some scientists suggest doctors could evaluate breast cancer using a less invasive technique called sentinel lymph node biopsy, where the first lymph nod...

Science researchers catch an early bird

...iornitheans--called "opposite birds" because their shoulder joint is reversed compared to that of modern birds--disappeared along with all non-avian dinosaurs at the end of the Cretaceous, leaving no descendants. Opposite birds dominate earlier fossil sites, such as the famous deposits in Liaoning Province (n...

No hobbits in this shire

...orsion twisting of the upper arm bone between the shoulder and elbow also was not a sign of a new species, but of developmental problems. The normal humeral torsion for a human is about 142 degrees, but LB1 has only 110 degrees of torsion. However, humeral torsion is influenced by both genetic and develop...

1 2

(Date:5/17/2013)... Shenzhen, China---- Why Tibetan antelope can live at ... a collaborative research published in Nature Communications ... institutes provide evidence that some genetic factors may ... highland environments. The data in this work will ... and the biology of other ruminant species. , ...
(Date:5/17/2013)... team of scientists using a new X-ray method recorded ... frog embryo in greater detail than ever before., This ... and the search for new treatments for genetic diseases., ... Technologie in Germany, in collaboration with the Advanced Photon ... Laboratory, released the most precise depiction ever of the ...
(Date:5/16/2013)... fast food restaurant had a higher body mass index ... food, according to researchers at The University of Texas ... strong among those with a lower income. , ... Journal of Public Health indicates higher BMI associates ... among lower-income African-Americans, the density, or number, of fast ...
Breaking Biology News(10 mins):The genome sequence of Tibetan antelope sheds new light on high-altitude adaptation 2New X-ray method shows how frog embryos could help thwart disease 2Body mass index of low income African-Americans linked to proximity of fast food restaurants 2Body mass index of low income African-Americans linked to proximity of fast food restaurants 3
Other Tags
naturetoldentrepreneursrepellentsfiringmixesriboswitchespeekscryingnighttimechronicinfantsmaasiowacabonathan