Tag: "stem" at biology news

32 new grants made for innovative technology R&D

...control of therapeutic genes in human adult neural stem cells that can be transplanted to treat incurable ocular diseases. Sarnoff Corporation (Princeton, N.J.) Advanced Vision-Radar Threat Detection (AVRT): A Pre-Crash Detection and Active Safety SystemCombine vision and radar sensor technology to...

An embryonic stem cell model for Parkinson's disease

...ake the case that a model based on mouse embryonic stem cells offers a promising platform for dissecting t...are hoping to extend their work to human embryonic stem cells, but their work is limited by the availability of such cells under the current NIH guidelines....

New biomaterials improve medical devices

...ill give an after-dinner talk on ethical issues in stem cell research. Educational grants for the Symposium have been provided by the Johnson & Johnson Family of Companies, the Center for Biomaterials & Advanced Technologies - a Division of Ethicon Inc., the Whitaker Foundation, Synnestvedt & Lechner L...

Most promising clinical uses for stem cells from fat agreed on by international society

...ions still remain about the nature and function of stem cells found in fat, a group of researchers and cli...ipose tissue, or fat, can be an abundant source of stem cells that could be used for tissue engineering and regenerative medicine. An important outcome of t...

Embryonic stem cells correct congenital heart defect in mouse embryos

...bes a previously unsuspected capacity of embryonic stem cells to influence neighboring defective cells and...n-Kettering Cancer Center report that 15 embryonic stem cells injected into early embryos of mice whose hearts were genetically predisposed to develop a let...

Researchers provide road map for generating B cells from stem cells

Before stem cells, of whatever origin, can be used to treat pa...h road map, suggesting how to lead a hematopoietic stem cell down the narrowing path to becoming an antibody-producing B cell. The researchers describe four...

Workshop on Responsible Stem Cell Research

...al government provides funding for human embryonic stem cell research only to scientists working on approved lines of pre-existing stem cells. Privately funded researchers at many businesses and academic institutions, however, are pursu...

Rice engineer wins prestigious Annunzio Award

... first researcher to isolate and culture embryonic stem cells; Nobel laureate Dr. James Cobey, an active leader in the International Campaign to Ban Landmines; influential architect Michael Graves, who designed several buildings on the Rice campus; and Dr. Anthony S. Fauci, a pioneer in the study of AIDS ...

Technique for genetically modifying blood stem cells brings cure for blood diseases closer

...cells in beta-thalassemia arise from hematopoietic stem cells (HSCs) in which both genes for beta-globin a...ble, and we need to get only one copy of it into a stem cell to produce significant amounts of fetal hemoglobin," Persons said. The ...

Touching research: How white blood cells navigate

...evices that capture rare but crucial cells such as stem cells and then release them as needed. The team brings a unique engineering viewpoint to a domain the human body that is often governed by physicians. The engineers are building artificial systems to simulate the subtle forces on blood cells; they...

Research into the sense of touch in worms wins Eppendorf/Science Prize

...laboratory working on mechanisms regulating neural stem cell self-renewal and cell fate choices, including interactions between neural stem cells and endothelial niche cells....

Muscling in on a deadly cancer

...le fibers. That is controversial because satellite stem cells cells that become new muscle long have bee... that occurs after the mouse is born and satellite stem cells give rise to new muscle cells. They engineered a version of the Pax3 gene that ...

Amphibians in dramatic decline; Up to 122 extinct since 1980

... and accelerated research on amphibian diseases to stem the extinction tide." Scientists from CI, IUCN, and NatureServe collaborated on the Global Amphibian Assessment. They analyzed data contributed by more than 500 of the world's leading amphibian specialists, and assessed each species for its le...

Leading scientists to discuss research applications for therapeutic cloning

...orted the successful harvesting of human embryonic stem cells from a cloned embryo. The cloning symposium,...try to legalize research cloning. Researchers hope stem cells derived from therapeutic cloning research will revolutionize medicine by providing better trea...

Mice thrive despite massive genetic makeover

...nome. Mice were subsequently generated from these stem cells. The research team then compared the resulting mice with the abridged genome to mice with the full-length version. A variety of features were analyzed, ranging from viability, growth, and longevity to numerous other biochemical and molecular f...

Neurosurgeons looking at stem cells from skin to fight brain tumors

... and scientists from Italy is looking into whether stem cells derived from a brain tumor patient's own ski...ght the tumors. The researchers successfully grew stem cells from skin samples of adult patients with brain tumors. It is hoped that these cells can then ...

Mouse study: 'Critical' Down syndrome region isn't

...of the engineered chromosomes into mouse embryonic stem cells, creating stem cells with either three copies of DSCR or only one copy of DSCR. These stem cells were then used to ...

Pesticides may promote Parkinson's disease and exercise may offer protection

...ase who are looking for safe and effective ways to stem the progression of the illness. In past studies, the researchers reported that rats forced to use limbs that mimicked the effects of Parkinson's could regain motor skills within a week of physical activity. When scientists later examined the rats' b...

Retinal stem cells can regenerate after transplant

... Toronto researchers have shown that human retinal stem cells transplanted into the eyes of mice and chick...ents the development of transplanted human retinal stem cells into light-sensing photoreceptor cells and retinal pigment epithelial (RPE) cells, the cells w...

Children's Hospital Boston geneticist awarded for research on muscular dystrophy

...Kunkel demonstrated that injection of either blood stem cells or muscle stem cells can partially restore dystrophin in affected skeletal muscles, a finding that may lead to trea...

1 2 3 4 5 6 7 8 9 10

(Date:5/21/2013)... battle? Try staying fit in space, where living quarters ... , That,s the challenge a group of Michigan State ... million grant from NASA. Their goal is to keep ... "You could give astronauts the best exercise regimen there ... to it, it isn,t going to help," said project ...
(Date:5/21/2013)... biomass experts , Where? Copenhagen, Denmark: ... 03-07 June 2013 , Why? ... market and policy developments, manufacturing and installation, drawing on ... from its 2013 edition from a record of more ... more than 240 plenary and oral presentations, more than ...
(Date:5/21/2013)... The epigenetic modifications, which alter the way genes ... apparently be detected in the blood of pregnant ... way to foretell depression in the weeks after ... symptoms become debilitating. , The findings of the ... online in the journal Molecular Psychiatry . ...
Breaking Biology News(10 mins):Fueling fitness on the final frontier 221st European Biomass Conference and Exhibition 221st European Biomass Conference and Exhibition 321st European Biomass Conference and Exhibition 4Genetic predictors of postpartum depression uncovered by Hopkins researchers 2Genetic predictors of postpartum depression uncovered by Hopkins researchers 3
Other Tags
deficitmammarymissilesguidedcoloradoinfluencesculturealoneopensdocumentedruinousmethamphtetamineflycheckfacedmetacognition