Tag: "strength" at biology news

Light-to-moderate prenatal alcohol exposure can lead to cognitive deficits 10 years later

...llected data on the timing of alcohol use and is a strength of the study." "Our study also showed that prenatal alcohol exposure was associated with lower IQ for African-American but not Caucasian children, said Willford. "Importantly, we know that this racial difference was not due to differences in the amo...

UGA study reveals a new way of looking at vaccine development

...hat effect is this likely to have?" Woods said the strength of his technique is its ability to be applied to various infectious diseases. The challenge is making immunologists and other scientists comfortable with computational modeling. To that end, he and his colleagues have established a Web site, http://g...

OHSU studying drug for bone-deforming disorder

..., who acknowledges that his significant upper-body strength has kept many of the disorder's most debilitating effects at bay. "They told me 'If you weren't as active as you are, you would be totally screwed up by now.' To be honest, that's what really swayed me to do this." The study, headed by Eric Orwoll, M...

Bedsores and bald hides: Novel roles revealed for a 'scaffolding' protein

...scarring." K17's role in maintaining hair follicle strength is probably centered on its capacity to control the timing of follicle cell death during normal hair growth cycles, says Coulombe. The team previously reported that mice lacking the K17 protein fail to grow a healthy coat of body hair during the fir...

Dolphins at risk

...h Blackwell Publishing, the Journal is moving from strength to strength. Now available both online and in print, the Journal is breaking new ground by being the first in the sector to be printed on 100 percent post-consumer waste recycled paper, as is appropriate for a publication dedicated to promoting envir...

Nature meets technology at Georgia Tech's conference on bio-inspired design

...will present findings on materials inspired by the strength of spider silk, the elasticity of cartilage, the arrangement of butterfly scales, the dry adhesion of gecko hairs for locomotion, fish teeth and the patterns and processes of diatom silica shells. Other researchers will present research on the propul...

A new view on Lyme disease: Rodents hold the key to annual risk

... the disease occurs in areas without oaks. But the strength of these findings suggests that the observed link between increased Lyme disease risk and high rodent densities indicates that important food sources--or predators--of the rodent hosts of nymphs will be valuable predictors of disease risk....

NIH holds state-of-the-science conference on multivitamin/mineral supplements, May 15 - 17, 2006

...nt use from expert groups vary widely, as does the strength of the evidence supporting such guidelines. In observational studies, MVM use has been associated with better health outcomes but there are few data available from randomized trials to provide more definitive evidence. As more and more Americans seek...

Mouse study reveals human X-SCID gene therapy poses substantial cancer risk

...s of their new findings. "We were surprised by the strength of the association between IL2RG gene therapy and development of lymphoma," says Woods. "These results suggest that curing X-SCID by replacing IL2RG in the manner it is currently being done puts patients at an increased risk of developing cancer." W...

NIH awards $13.3 million to Carnegie Mellon, University of Pittsburgh

...gnizes our visionary science and the collaborative strength of both universities in advancing this exciting new field," said Mark Kamlet, senior vice president and provost of Carnegie Mellon. "This major grant will give us even greater capabilities to produce innovative biotechnologies that impact tomorrow's ...

Interdisciplinary team develops guidelines for treating severely injured patients

...s for trauma and burn patients often depend on the strength of their inflammatory response to their injury. Inflammation helps the healing process in many cases, but an excessive response can lead to multiple organ failure, a common cause of death following a traumatic injury. "Thanks to the increased skills ...

USC receives first round of stem cell training funds

....D./Ph.D. program. "The biomedical environment and strength of stem cell research at Childrens Hospital Los Angeles and the Keck School of Medicine combine to provide a rich milieu for training the next generation of physicians and scientists who will use stem cells as the basis for research and therapy," sai...

Farm study raises doubts about new approach to swine-disease control

...dy found that the approach boosted development and strength of immunity against the local strain, but failed where it counted the most. Pigs exposed to the farm's virus produced slightly more live births than pigs vaccinated two other ways, but many of these acclimatized animals never gave birth at all and ha...

First clinical trial of gene therapy for muscular dystrophy now under way

...ce, as well as extensive testing of the health and strength of the trial participants, will reveal whether gen... muscles degenerate over time, the person's muscle strength declines. Duchenne muscular dystrophy is a genetic disease that begins in early childhood, causes pr...

Alaska timber projection study reveals market trends

.... Marketing of Alaska timber stresses the superior strength values of Alaska species in engineered wood products to stimulate demand. The National Forest System becomes a certified producer of sustainable products eliminating the constant challenges to the timber program. Low-grade logs are used to produce c...

Getting ACL tears to heal themselves

...cells to fill in the defect and restore mechanical strength to the ligament. "This is a first important step i...fects also had a 40 percent increase in mechanical strength at 6 weeks, compared with just 14 percent for untreated defects. Although she cautions that these re...

Rice bioengineers pioneer techniques for knee repair

...ut they are still trying to perfect the mechanical strength of the engineered meniscus tissue, which must be able to withstand up to an astounding 2,400 pounds per square inch of compressive pressure....

Moderate lifetime reductions in LDL cholesterol dramatically reduce risk of heart disease

...ent decrease in coronary heart disease. "A major strength of this study," Hobbs said, "is that you have two independent populations with different sequence variations in the same gene, that impact on a trait of interest, and you see similar kinds of effects." The difference in LDL cholesterol between indi...

Electrical stimulation boosts stroke recovery

...proved "significantly" better in hand mobility and strength tests than people undergoing rehabilitation alone. "Everybody improved to some degree, because even in the subjects who received some rehabilitation, we did see improvement," Lutsep said. "What the data suggested is those who received the (stimulati...

EPSRC and Philips announce new strategic alliance

...ostic medical imaging market. Part of the Philips' strength in healthcare innovation has been founded on research in collaboration with leading universities and clinical sites; the alliance with EPSRC fits in this strategy. EPSRC benefits from the alliance because its mission is to provide a research foundati...

1 2 3 4 5 6 7 8 9 10

(Date:5/22/2013)... (NLST) investigators also conclude that the 20 percent ... tomography (LDCT) versus chest X-ray (CXR) screening previously ... at experienced screening centers in the United States. ... with their patients about the benefits and risks ... in the New England Journal of Medicine ...
(Date:5/22/2013)... Harvard physicists have developed a novel technique that can ... a process that is one of the most important, ... described in a paper in Nature , post-doctoral ... Dr. Melanie Schnell of the Center for Free-Electron Laser ... relies on finely-tuned microwave fields to identify molecular variants ...
(Date:5/22/2013)... Md. (May 22, 2013)The omega 3 fatty acids in ... cardiovascular diseaseso much so that the American Heart Association ... a week, particularly fatty varieties rich in omega 3s. ... a mystery. In a new study, scientists led by ... on this phenomenon by providing evidence that fish oil ...
Breaking Biology News(10 mins):NLST: CT detects twice as many lung cancers as X-ray at initial screening exam 2NLST: CT detects twice as many lung cancers as X-ray at initial screening exam 3Detecting mirror molecules 2Detecting mirror molecules 3Fish oil may help the heart beat mental stress 2
Other Tags
reversiblyswitchesmitslittlerappliesspecificityforeveraustraliansrelyfeversovertakemortemscarspresentingpodcastcore