Tag: "studies" at biology news

Gene expression profiling aids in ovarian cancer prognosis

...rther evaluate this technology through prospective studies of patients with both advanced ovarian cancer, as well as early stage disease. "The use of a powerful prognostic tool such as the OCPP may someday enable clinicians to identify those patients most appropriate for clinical tria...

A 'repulsive' protein guides blood vessel development

...guide neural development. The researchers said the studies provide more evidence that there is communication between developing nerves and blood vessels. Understanding how those networks communicate with each other could help researchers devise methods to prevent blood vessel growth in tumors selectively an...

How the sea urchin grows new spines

...e, yet precise, growth pattern. Though previous studies by the Weizmann group have shown the same strategy is used by immature sea urchins and mollusks in the larval stage to build internal skeletons, this is the first time that the process was observed in adult marine animals. It is far from obvious that...

Heart responds to fasting by remodeling vital energy-producing components

...ications for human cardiovascular health. In their studies of mouse heart muscle, the research team found lev...nd a partial explanation to a pattern discerned in studies of ischemic heart patients, who have restricted blood flow to the heart. "While we have to be carefu...

Good news about vitamin E

... Dr. Levy had demonstrated in multiple previous studies that haptoglobin 2-2 is predictive of heart disease -- but only in people with diabetes. That's because diabetics tend to have more free radicals that destroy antioxidants. Furthermore, haptoglobin 2-2 is a very poor antioxidant when compared to th...

New bulls may revive the Texas state Bison Herd

... as cattle," he said. Our hope is that when these studies are completed, they will form a model of the kinds of studies using genetic technology that can be used to preserve, conserve, and reconstruct many other wildlife...

'Blind' cells see the light; maybe someday humans will, too

...member of the campus's Health Sciences Initiative, studies ion channels -- protein valves that regulate the flow of charged atoms in and out of cells. Spanning the membranes of nerve cells, sodium and potassium channels, in particular, facilitate the transmission of electrical signals along the length of the...

Acid-resistant bug doesn't give in to alcohol either

...e more long-range goal is to involve insights from studies of this bacterium with the numerous diseases caused by protein mis-folding. Alzheimer's disease, Lou Gehrig's disease, and possibly even cataracts begin with mis-folded proteins. "A lot of times a mild acid-mediated unfolding of an enzyme preci...

UCI researchers use human embryonic stem cells to aid spinal cord injury repair

... wrapping around neurons in the spinal cord. These studies demonstrated that the oligodendrocytes derived from human embryonic stem cells can function in a living system. Results of this study are published online in the peer-reviewed journal "Glia." "These results are extremely exciting and show great pro...

Low-carb diet during pregnancy improved triglycerides, fat metabolism in offspring

...adult offspring" will appear as one of 20 research studies on fetal programming (how a mother's actions affect her offspring) presented in the January 2005 edition of the American Journal of Physiology Regulatory, Integrative, and Comparative Physiology . The authors of the study are Junlong Zhang, Chunl...

Studies suggest promising new directions for gallstone treatment

...bile acid secretion by the liver, according to new studies by Howard Hughes Medical Institute researchers. Th... which afflicts some 20 million people a year. The studies also propose novel strategies for developing diagnostic tests to identify people with a genetically ...

Are animals as irrational as humans?

...he case of animals, reproductive success. Yet many studies report that when making decisions people often tak...Paim and co-authors argue, these results warn that studies appropriating ideas from other disciplines can introduce confounding effects. Researchers would do w...

Peripheral timekeeping: Mammalian cells outside the brain have their own circadian clocks

... SCN but also in many other tissues. Some of these studies used the firefly luciferase gene, introduced into cells with regulatory elements from a clock gene, so that cell cultures emitted light with a circadian rhythm. However, peripheral tissue rhythms tended diminish after a few cycles in culture, suggest...

Scientists generate human islet precursor cells in culture

...es of beta cells. The researchers hope that future studies will corroborate their findings and address some o...ons. For example, the researchers plan to conduct studies to try to define the optimal environmental conditions to grow precursor cells and to stimulate them ...

A new species of amyloid peptide

... Xuemin Xu of The University of Tennessee. "Recent studies also suggest that the intracellular C-terminal domain of the amyloid precursor protein may function as a transcription factor." While the exact pathogenic role of amyloid β-peptide in Alzheimer's disease has not yet been definitely established, ...

'Lighter than air' breathing more than doubles COPD patients' exercise endurance

...e COPD patients." However, they note that "further studies are needed to verify the potential role of heliox supplementation during exercise rehabilitation programs in COPD patients." ...

Finding could improve safety of stem cell transplants

..., MCG biochemist and the study's lead author. "Our studies show this particular mechanism can help stem cells safely become the cells we want them to be." "This is another approach to controlling differentiation and getting the cell types that you want," says Dr. Brian G. Condie, developmental neurobiol...

MBL scientists embark on international effort to uncover microbial diversity in world's oceans

..., integration of diverse communities, and enabling studies that will explore processes--whether ecological or evolutionary," said Sogin. "A problem of this magnitude requires careful planning and international cooperation." Over the next two years, ICoMM organizers will focus on building a framework for ...

Psychological stress and disease: UCSF-led study suggests connection

...lar aging." The link from mind to body "Numerous studies have solidly demonstrated a link between chronic psychological stress and indices of impaired health, including cardiovascular disease and weakened immune function," says lead author Elissa Epel, PhD, UCSF assistant professor of psychiatry. "The new ...

Study in Royal Society journal on possible genetic factors in social responsiblity

... The focus of inbreeding depression studies has been on viability, with much less attention be...DNA in Parus and its relevance for phylogeographic studies by Professor RM Zink Thousands of studies in the last two decades have compared DNA sequences a...

1 2 3 4 5 6 7 8 9 10

(Date:6/17/2013)... 2013 An international team led by scientists at ... Institute and Albert Einstein College of Medicine of Yeshiva ... that attacks the tuberculosis (TB) bacterium in two different ... solve one of the major global health crises of ... strains," said Peter G. Schultz, the Scripps Family Chair ...
(Date:6/17/2013)... ST. LOUIS -- In research published in Biochemical ... describe a technology that can detect new, previously unknown ... for viruses even when doctors have not identified a ... , In the new approach, scientists use ... discover viruses. , Taking advantage of the complete deciphering ...
(Date:6/17/2013)... early onset of puberty in girls, a new clinical ... Endocrine Society,s 95th Annual Meeting in San Francisco. , ... 10 and 14. Boys undergo these changes later, usually ... is diagnosed in girls when sexual development begins before ... when these changes occur before age 9. , Recently, ...
Breaking Biology News(10 mins):New compound excels at killing persistent and drug-resistant tuberculosis 2New compound excels at killing persistent and drug-resistant tuberculosis 3New compound excels at killing persistent and drug-resistant tuberculosis 4Saint Louis University researchers discover a way to detect new viruses 2Saint Louis University researchers discover a way to detect new viruses 3Vitamin D supplementation may delay precocious puberty in girls 2
Other Tags
capillarymaterialisemisshapentacticsoupamchitkapassivelawnsstaraffirmsmelodyunbornregretbeverageassurefao