Tag: "synovial" at biology news

CTRC enrolls first patients in novel phase II study for sarcoma -- living virus destroys cancer cell

...oma family tumors, malignant fibrous histiocytoma, synovial sarcoma, fibrosarcoma and leiomyosarcoma. The second patient to enroll in the study was diagnosed with breast cancer in April 2005 and 11 months later received an additional diagnosis for a rare form of sarcoma. A specialist at the Dana-Farber Ca...

Mouse model advances understanding of synovial sarcoma

A mouse model for synovial sarcoma has enabled scientists to make tremendous ...ronment required for initiation and progression of synovial sarcoma. The mouse model is also likely to serve as an invaluable resource for development of succes...

Progress against sarcoma

... geneticists have engineered mice that can develop synovial sarcoma a significant early step toward developin..., cancer-stricken mice were used to determine that synovial sarcoma develops in muscle cell precursors known as myoblasts, the researchers report in the April i...

New genes implicated in rheumatoid arthritis

... of the most significantly over-expressed genes in synovial tissues. In addition, they compared gene expression in synovial tissue of the RA patients with gene expression in synovial tissue of patients with osteoarthritis (O...

Bionic fiction becomes science fact

... real hand, where a muscle pulls a tendon inside a synovial sheath, CYBERHAND's finger cables run through a Teflon sheath pulled by a DC motor. So the proximal, medial and distal phalanges, those bones between your finger knuckles, are all driven by the same tendon. This approach is called underactuation as t...

Hope for arthritis, heart attack, stroke relief found in unique 'acid active' receptor

... various forms of arthritis, where the pH of joint synovial fluid can be as low as 6, well below normal physio... and the normal physiologic pH is 7.4). "The thin synovial lining of a joint capsule is normally made up of only one to four layers of synoviocytes (synovial c...

JCI table of contents November, 2005

...a help explain why RA encompasses several types of synovial inflammation, with distinct disease mechanisms and differential responsiveness to therapy. TITLE: BLyS and APRIL in Rheumatoid Arthritis AUTHOR CONTACT: Cornelia Weyand Emory University School of Medicine, Atlanta, GA USA Phone: (404) 727-7310; ...

Arthritis: What Wnt wrong?

...y cytokines were produced in primary cartilage and synovial cells from arthritic versus normal joints. While OA cells did not differ from controls, primary RA cells produced TNF-a, IL-1 and IL-6 at levels 2- to 4-fold above controls. Importantly, this effect could be replicated in normal cells when they wer...

Results of world's first gene therapy trial for arthritis show approach safe, feasible

...odulate communication between the immune cells and synovial cells, the cells that line the joint. As the researchers discovered in earlier animal studies, synovial cells have a receptor on their surface that's a perfect fit for a particular cytokine, interleukin-1...

JCI table of contents March 1, 2005

... lubricin protects cartilage surfaces and inhibits synovial cell overgrowth AUTHOR CONTACT:Matthew Warman Case Western Reserve University, Cleveland, OH USA Phone: (216) 368-1681; E-mail: mlw14@case.edu Vie...

1

(Date:11/12/2014)... 12, 2014 Crossmatch™, a leading provider of ... ® fingerprint readers have been deployed throughout Montparnasse ... Central Mexico . The bakery chain implemented the ... issues caused by employees clocking in for each other. ... readers, Montparnasse relied on paper timecards and a mechanical ...
(Date:11/7/2014)... Dr. Debra Auguste, associate professor, biomedical engineering, in ... College of New York, have identified a molecule ... of the most aggressive forms of breast cancer. ... high mortality rate owing to aggressive proliferation and ... However, Professor Auguste,s team, discovered the overexpression of ...
(Date:11/6/2014)... groundbreaking paper from a team of Florida State University ... plants could adapt to and survive environmental swings such ... the latest issue of the journal The Plant ... of DNA and proteins) is organized in a cell ... genes are turned on and others are turned off. ...
Breaking Biology News(10 mins):Montparnasse Pasteleria Achieves Time and Attendance Transparency with Crossmatch U.are.U Fingerprint Readers 2Maize analysis yields whole new world of genetic science 2
Other Tags
bloomduecorpsesmellyvalvesimplifyarisingschrenkinsurancecirrhosiscelecoxibtooculpritfindresearchersstanford